Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5232038..5232663 | Replicon | chromosome |
Accession | NZ_CP106786 | ||
Organism | Klebsiella pneumoniae strain KP1161 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | N9H76_RS25520 | Protein ID | WP_002882817.1 |
Coordinates | 5232038..5232421 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N9H76_RS25525 | Protein ID | WP_075210489.1 |
Coordinates | 5232421..5232663 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9H76_RS25505 (N9H76_25505) | 5229403..5230306 | + | 904 | Protein_4983 | formate dehydrogenase subunit beta | - |
N9H76_RS25510 (N9H76_25510) | 5230303..5230938 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N9H76_RS25515 (N9H76_25515) | 5230935..5231864 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N9H76_RS25520 (N9H76_25520) | 5232038..5232421 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N9H76_RS25525 (N9H76_25525) | 5232421..5232663 | - | 243 | WP_075210489.1 | CopG family transcriptional regulator | Antitoxin |
N9H76_RS25530 (N9H76_25530) | 5232868..5233785 | + | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
N9H76_RS25535 (N9H76_25535) | 5233799..5234740 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N9H76_RS25540 (N9H76_25540) | 5234785..5235222 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N9H76_RS25545 (N9H76_25545) | 5235219..5236079 | - | 861 | WP_023280688.1 | virulence factor BrkB family protein | - |
N9H76_RS25550 (N9H76_25550) | 5236073..5236672 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T259828 WP_002882817.1 NZ_CP106786:c5232421-5232038 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|