Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4782802..4783318 | Replicon | chromosome |
| Accession | NZ_CP106786 | ||
| Organism | Klebsiella pneumoniae strain KP1161 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N9H76_RS23435 | Protein ID | WP_021469513.1 |
| Coordinates | 4783034..4783318 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | N9H76_RS23430 | Protein ID | WP_002886901.1 |
| Coordinates | 4782802..4783044 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N9H76_RS23415 (N9H76_23415) | 4778830..4779570 | + | 741 | WP_032412667.1 | KDGP aldolase family protein | - |
| N9H76_RS23420 (N9H76_23420) | 4779637..4780791 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| N9H76_RS23425 (N9H76_23425) | 4780814..4782724 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| N9H76_RS23430 (N9H76_23430) | 4782802..4783044 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N9H76_RS23435 (N9H76_23435) | 4783034..4783318 | + | 285 | WP_021469513.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N9H76_RS23440 (N9H76_23440) | 4783322..4783786 | - | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N9H76_RS23445 (N9H76_23445) | 4784035..4786173 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N9H76_RS23450 (N9H76_23450) | 4786530..4787273 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| N9H76_RS23455 (N9H76_23455) | 4787276..4787449 | - | 174 | WP_004222159.1 | hypothetical protein | - |
| N9H76_RS23460 (N9H76_23460) | 4787579..4787842 | + | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11083.95 Da Isoelectric Point: 10.4962
>T259826 WP_021469513.1 NZ_CP106786:4783034-4783318 [Klebsiella pneumoniae]
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELAFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|