Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4070098..4070717 | Replicon | chromosome |
Accession | NZ_CP106786 | ||
Organism | Klebsiella pneumoniae strain KP1161 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | N9H76_RS19960 | Protein ID | WP_002892050.1 |
Coordinates | 4070499..4070717 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | N9H76_RS19955 | Protein ID | WP_002892066.1 |
Coordinates | 4070098..4070472 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9H76_RS19945 (N9H76_19945) | 4065250..4066443 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N9H76_RS19950 (N9H76_19950) | 4066466..4069612 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
N9H76_RS19955 (N9H76_19955) | 4070098..4070472 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
N9H76_RS19960 (N9H76_19960) | 4070499..4070717 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
N9H76_RS19965 (N9H76_19965) | 4070876..4071442 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
N9H76_RS19970 (N9H76_19970) | 4071414..4071554 | - | 141 | WP_004147370.1 | hypothetical protein | - |
N9H76_RS19975 (N9H76_19975) | 4071575..4072045 | + | 471 | WP_002892026.1 | YlaC family protein | - |
N9H76_RS19980 (N9H76_19980) | 4072020..4073471 | - | 1452 | WP_021313732.1 | PLP-dependent aminotransferase family protein | - |
N9H76_RS19985 (N9H76_19985) | 4073572..4074270 | + | 699 | WP_002892021.1 | GNAT family protein | - |
N9H76_RS19990 (N9H76_19990) | 4074267..4074407 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
N9H76_RS19995 (N9H76_19995) | 4074407..4074670 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T259824 WP_002892050.1 NZ_CP106786:4070499-4070717 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT259824 WP_002892066.1 NZ_CP106786:4070098-4070472 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |