Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4070098..4070717 Replicon chromosome
Accession NZ_CP106786
Organism Klebsiella pneumoniae strain KP1161

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N9H76_RS19960 Protein ID WP_002892050.1
Coordinates 4070499..4070717 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N9H76_RS19955 Protein ID WP_002892066.1
Coordinates 4070098..4070472 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N9H76_RS19945 (N9H76_19945) 4065250..4066443 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N9H76_RS19950 (N9H76_19950) 4066466..4069612 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N9H76_RS19955 (N9H76_19955) 4070098..4070472 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N9H76_RS19960 (N9H76_19960) 4070499..4070717 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N9H76_RS19965 (N9H76_19965) 4070876..4071442 + 567 WP_002892030.1 maltose O-acetyltransferase -
N9H76_RS19970 (N9H76_19970) 4071414..4071554 - 141 WP_004147370.1 hypothetical protein -
N9H76_RS19975 (N9H76_19975) 4071575..4072045 + 471 WP_002892026.1 YlaC family protein -
N9H76_RS19980 (N9H76_19980) 4072020..4073471 - 1452 WP_021313732.1 PLP-dependent aminotransferase family protein -
N9H76_RS19985 (N9H76_19985) 4073572..4074270 + 699 WP_002892021.1 GNAT family protein -
N9H76_RS19990 (N9H76_19990) 4074267..4074407 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N9H76_RS19995 (N9H76_19995) 4074407..4074670 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259824 WP_002892050.1 NZ_CP106786:4070499-4070717 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259824 WP_002892066.1 NZ_CP106786:4070098-4070472 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References