Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 911186..911856 Replicon chromosome
Accession NZ_CP106786
Organism Klebsiella pneumoniae strain KP1161

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag N9H76_RS04610 Protein ID WP_004213072.1
Coordinates 911413..911856 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag N9H76_RS04605 Protein ID WP_004213073.1
Coordinates 911186..911416 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N9H76_RS04580 (N9H76_04580) 907409..908308 - 900 WP_004225022.1 nucleotide-binding protein -
N9H76_RS04585 (N9H76_04585) 908298..908588 - 291 WP_004213078.1 hypothetical protein -
N9H76_RS04590 (N9H76_04590) 908940..909146 + 207 WP_004213077.1 hypothetical protein -
N9H76_RS04595 (N9H76_04595) 909136..909429 - 294 WP_004213076.1 hypothetical protein -
N9H76_RS04600 (N9H76_04600) 909445..910578 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
N9H76_RS04605 (N9H76_04605) 911186..911416 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N9H76_RS04610 (N9H76_04610) 911413..911856 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
N9H76_RS04615 (N9H76_04615) 912005..912256 + 252 WP_186987481.1 hypothetical protein -
N9H76_RS04620 (N9H76_04620) 912279..912583 - 305 Protein_909 transposase -
N9H76_RS04625 (N9H76_04625) 913000..913637 + 638 Protein_910 mucoid phenotype regulator RmpA2 -
N9H76_RS04630 (N9H76_04630) 914155..914558 - 404 Protein_911 GAF domain-containing protein -
N9H76_RS04635 (N9H76_04635) 914649..915569 - 921 WP_004213934.1 DUF1471 domain-containing protein -
N9H76_RS04640 (N9H76_04640) 915618..916109 - 492 WP_011251327.1 DM13 domain-containing protein -
N9H76_RS04645 (N9H76_04645) 916172..916438 - 267 WP_147021650.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T259815 WP_004213072.1 NZ_CP106786:911413-911856 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT259815 WP_004213073.1 NZ_CP106786:911186-911416 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References