Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5234453..5235080 | Replicon | chromosome |
Accession | NZ_CP106785 | ||
Organism | Pseudomonas tohonis strain G5.110 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N9L84_RS24005 | Protein ID | WP_263151077.1 |
Coordinates | 5234898..5235080 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N9L84_RS24000 | Protein ID | WP_263151076.1 |
Coordinates | 5234453..5234860 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9L84_RS23990 (N9L84_23990) | 5232289..5233296 | + | 1008 | WP_263151074.1 | nucleoid-associated protein YejK | - |
N9L84_RS23995 (N9L84_23995) | 5233355..5234290 | - | 936 | WP_263151075.1 | glutathione S-transferase family protein | - |
N9L84_RS24000 (N9L84_24000) | 5234453..5234860 | - | 408 | WP_263151076.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N9L84_RS24005 (N9L84_24005) | 5234898..5235080 | - | 183 | WP_263151077.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N9L84_RS24010 (N9L84_24010) | 5235223..5235531 | - | 309 | WP_263151078.1 | GIY-YIG nuclease family protein | - |
N9L84_RS24015 (N9L84_24015) | 5235528..5236226 | - | 699 | WP_263151079.1 | glutathione S-transferase family protein | - |
N9L84_RS24020 (N9L84_24020) | 5236308..5236778 | - | 471 | WP_263151080.1 | nuclear transport factor 2 family protein | - |
N9L84_RS24025 (N9L84_24025) | 5236895..5237848 | + | 954 | WP_263151081.1 | helix-turn-helix domain-containing protein | - |
N9L84_RS24030 (N9L84_24030) | 5238302..5239063 | - | 762 | WP_111263764.1 | amino acid ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6841.90 Da Isoelectric Point: 10.5627
>T259811 WP_263151077.1 NZ_CP106785:c5235080-5234898 [Pseudomonas tohonis]
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
MRSREVIEKIKEDGWYEVDVKGSHHQFKHPSKPGRVTVPHPRSDLPIGTVRSILKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14523.38 Da Isoelectric Point: 4.3759
>AT259811 WP_263151076.1 NZ_CP106785:c5234860-5234453 [Pseudomonas tohonis]
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
MKFPIVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGETLPQAQQIDVYIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLRRIDERVGKDARYASRSGFLATAALRELSDAS
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|