Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 4420419..4421016 | Replicon | chromosome |
| Accession | NZ_CP106785 | ||
| Organism | Pseudomonas tohonis strain G5.110 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N9L84_RS20100 | Protein ID | WP_263150462.1 |
| Coordinates | 4420419..4420727 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | N9L84_RS20105 | Protein ID | WP_173177962.1 |
| Coordinates | 4420720..4421016 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N9L84_RS20085 (N9L84_20085) | 4416431..4418068 | - | 1638 | WP_263150457.1 | AMP-binding protein | - |
| N9L84_RS20090 (N9L84_20090) | 4418181..4419011 | - | 831 | WP_263150458.1 | amidohydrolase family protein | - |
| N9L84_RS20095 (N9L84_20095) | 4419079..4420218 | - | 1140 | WP_263150460.1 | acyl-CoA dehydrogenase family protein | - |
| N9L84_RS20100 (N9L84_20100) | 4420419..4420727 | + | 309 | WP_263150462.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N9L84_RS20105 (N9L84_20105) | 4420720..4421016 | + | 297 | WP_173177962.1 | putative addiction module antidote protein | Antitoxin |
| N9L84_RS20110 (N9L84_20110) | 4421107..4422393 | - | 1287 | WP_263150463.1 | dicarboxylate/amino acid:cation symporter | - |
| N9L84_RS20115 (N9L84_20115) | 4422717..4423715 | + | 999 | WP_263150464.1 | AraC family transcriptional regulator | - |
| N9L84_RS20120 (N9L84_20120) | 4423773..4424090 | - | 318 | WP_263150465.1 | putative quinol monooxygenase | - |
| N9L84_RS20125 (N9L84_20125) | 4424253..4424843 | + | 591 | WP_213625612.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11386.11 Da Isoelectric Point: 10.8297
>T259808 WP_263150462.1 NZ_CP106785:4420419-4420727 [Pseudomonas tohonis]
MIKVLQSRAFATWLNHLSDGKARARILARIDRMADGHLGDVAPIGEGLSEARLHFGPGYRLYFLQRGRFLIVLLCGGDKG
SQGRDIGHARRIAAAWKEQHHD
MIKVLQSRAFATWLNHLSDGKARARILARIDRMADGHLGDVAPIGEGLSEARLHFGPGYRLYFLQRGRFLIVLLCGGDKG
SQGRDIGHARRIAAAWKEQHHD
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|