Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 3931884..3932517 | Replicon | chromosome |
| Accession | NZ_CP106785 | ||
| Organism | Pseudomonas tohonis strain G5.110 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N9L84_RS17775 | Protein ID | WP_263150043.1 |
| Coordinates | 3931884..3932255 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N9L84_RS17780 | Protein ID | WP_263150045.1 |
| Coordinates | 3932281..3932517 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N9L84_RS17740 (N9L84_17740) | 3927021..3927293 | + | 273 | WP_021217973.1 | DUF2282 domain-containing protein | - |
| N9L84_RS17745 (N9L84_17745) | 3927310..3928149 | + | 840 | WP_263150034.1 | DUF692 domain-containing protein | - |
| N9L84_RS17750 (N9L84_17750) | 3928146..3928931 | + | 786 | WP_263150035.1 | DNA-binding domain-containing protein | - |
| N9L84_RS17755 (N9L84_17755) | 3928945..3929409 | + | 465 | WP_263150037.1 | DoxX family protein | - |
| N9L84_RS17760 (N9L84_17760) | 3929417..3930013 | - | 597 | WP_263150039.1 | chalcone isomerase family protein | - |
| N9L84_RS17765 (N9L84_17765) | 3930087..3930983 | - | 897 | WP_263150040.1 | alpha/beta hydrolase | - |
| N9L84_RS17770 (N9L84_17770) | 3931108..3931875 | + | 768 | WP_263150041.1 | DUF2092 domain-containing protein | - |
| N9L84_RS17775 (N9L84_17775) | 3931884..3932255 | - | 372 | WP_263150043.1 | PIN domain-containing protein | Toxin |
| N9L84_RS17780 (N9L84_17780) | 3932281..3932517 | - | 237 | WP_263150045.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| N9L84_RS17785 (N9L84_17785) | 3932657..3933289 | + | 633 | WP_263150046.1 | hypothetical protein | - |
| N9L84_RS17790 (N9L84_17790) | 3933462..3934376 | - | 915 | WP_263150047.1 | LysR family transcriptional regulator | - |
| N9L84_RS17795 (N9L84_17795) | 3934535..3935872 | + | 1338 | WP_263150049.1 | nucleobase:cation symporter-2 family protein | - |
| N9L84_RS17800 (N9L84_17800) | 3935912..3936418 | + | 507 | WP_263150050.1 | nucleoside deaminase | - |
| N9L84_RS17805 (N9L84_17805) | 3936415..3936771 | + | 357 | WP_263150052.1 | hydroxyisourate hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13568.81 Da Isoelectric Point: 7.1892
>T259807 WP_263150043.1 NZ_CP106785:c3932255-3931884 [Pseudomonas tohonis]
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLLDGRLRVLNPFG
VLLYLLSADPAKADAAEALLAKRPTISVQVLNEVASVCSRKLRMSWDEIGRFLELVQGFCRVVPVTLEIHRQARELAERY
RLSFYDACIAAAALVAGCSTLHSEDMHSGLLLDGRLRVLNPFG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|