Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3650576..3651251 | Replicon | chromosome |
Accession | NZ_CP106785 | ||
Organism | Pseudomonas tohonis strain G5.110 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N9L84_RS16575 | Protein ID | WP_263149783.1 |
Coordinates | 3650576..3650761 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N9L84_RS16580 | Protein ID | WP_263149784.1 |
Coordinates | 3650808..3651251 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9L84_RS16550 (N9L84_16550) | 3645611..3646309 | - | 699 | WP_263149776.1 | phytanoyl-CoA dioxygenase family protein | - |
N9L84_RS16555 (N9L84_16555) | 3646306..3646863 | - | 558 | WP_263149778.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
N9L84_RS16560 (N9L84_16560) | 3647665..3648216 | - | 552 | WP_263149779.1 | hypothetical protein | - |
N9L84_RS16565 (N9L84_16565) | 3648508..3649575 | - | 1068 | WP_263149780.1 | hypothetical protein | - |
N9L84_RS16570 (N9L84_16570) | 3649793..3650149 | - | 357 | WP_263149781.1 | hypothetical protein | - |
N9L84_RS16575 (N9L84_16575) | 3650576..3650761 | + | 186 | WP_263149783.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N9L84_RS16580 (N9L84_16580) | 3650808..3651251 | + | 444 | WP_263149784.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N9L84_RS16585 (N9L84_16585) | 3651485..3652135 | + | 651 | WP_263149785.1 | hypothetical protein | - |
N9L84_RS16590 (N9L84_16590) | 3652163..3652720 | + | 558 | WP_263149786.1 | hypothetical protein | - |
N9L84_RS16595 (N9L84_16595) | 3653006..3655081 | - | 2076 | WP_263149787.1 | phospholipase C, phosphocholine-specific | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6881.04 Da Isoelectric Point: 10.8832
>T259806 WP_263149783.1 NZ_CP106785:3650576-3650761 [Pseudomonas tohonis]
MKHSEFRRWLKAQGVIFEAAKGSHFKITAPNGKTTIFADHGAKEMKEPTRKAIIKQLGLTE
MKHSEFRRWLKAQGVIFEAAKGSHFKITAPNGKTTIFADHGAKEMKEPTRKAIIKQLGLTE
Download Length: 186 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16141.54 Da Isoelectric Point: 4.6651
>AT259806 WP_263149784.1 NZ_CP106785:3650808-3651251 [Pseudomonas tohonis]
MYDYAIRLEADDTPGLAVFCRDLPELNSYGDDVAHALAEAVDAIESTLSLYVDQRRTIPTASPAEAGEHVIRLPAVTVAK
IYLWNAMMEQGLRKADLCRLLGVAPMQVDRLVDFLHTSKMEAVETALAKLGKRLAVSIEAGEWPRSA
MYDYAIRLEADDTPGLAVFCRDLPELNSYGDDVAHALAEAVDAIESTLSLYVDQRRTIPTASPAEAGEHVIRLPAVTVAK
IYLWNAMMEQGLRKADLCRLLGVAPMQVDRLVDFLHTSKMEAVETALAKLGKRLAVSIEAGEWPRSA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|