Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1809799..1810388 | Replicon | chromosome |
Accession | NZ_CP106785 | ||
Organism | Pseudomonas tohonis strain G5.110 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | N9L84_RS08430 | Protein ID | WP_263153316.1 |
Coordinates | 1809799..1810098 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | N9L84_RS08435 | Protein ID | WP_263153318.1 |
Coordinates | 1810095..1810388 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9L84_RS08400 (N9L84_08400) | 1804967..1806502 | + | 1536 | WP_263153313.1 | DHA2 family efflux MFS transporter permease subunit | - |
N9L84_RS08410 (N9L84_08410) | 1806905..1807126 | - | 222 | WP_021219560.1 | YgdI/YgdR family lipoprotein | - |
N9L84_RS08415 (N9L84_08415) | 1807211..1807798 | - | 588 | WP_263153314.1 | molybdenum cofactor guanylyltransferase MobA | - |
N9L84_RS08420 (N9L84_08420) | 1807871..1808410 | + | 540 | WP_173173724.1 | molybdenum cofactor biosynthesis protein B | - |
N9L84_RS08425 (N9L84_08425) | 1808407..1809621 | + | 1215 | WP_213628903.1 | molybdopterin molybdotransferase MoeA | - |
N9L84_RS08430 (N9L84_08430) | 1809799..1810098 | + | 300 | WP_263153316.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N9L84_RS08435 (N9L84_08435) | 1810095..1810388 | + | 294 | WP_263153318.1 | putative addiction module antidote protein | Antitoxin |
N9L84_RS08440 (N9L84_08440) | 1810389..1811411 | - | 1023 | WP_263153319.1 | AraC family transcriptional regulator | - |
N9L84_RS08445 (N9L84_08445) | 1811544..1813139 | + | 1596 | WP_263153320.1 | FAD-binding oxidoreductase | - |
N9L84_RS08450 (N9L84_08450) | 1813142..1814719 | + | 1578 | WP_263153321.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11092.73 Da Isoelectric Point: 11.1304
>T259804 WP_263153316.1 NZ_CP106785:1809799-1810098 [Pseudomonas tohonis]
MITIRQTATFAAWERKLKDRKARAAIAARIFRLANGLPGDVAPVGQGVSEMRINYGPGYRVYFQQRGNELVILLCGGDKS
SQGRDIEQARRLAAEWRSQ
MITIRQTATFAAWERKLKDRKARAAIAARIFRLANGLPGDVAPVGQGVSEMRINYGPGYRVYFQQRGNELVILLCGGDKS
SQGRDIEQARRLAAEWRSQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|