Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2757965..2759007 | Replicon | chromosome |
Accession | NZ_CP106784 | ||
Organism | Pseudomonas aeruginosa strain NY5085 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | N9J97_RS13260 | Protein ID | WP_003153636.1 |
Coordinates | 2758432..2759007 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | N9J97_RS13255 | Protein ID | WP_003050245.1 |
Coordinates | 2757965..2758435 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9J97_RS13220 (N9J97_13220) | 2753344..2754762 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
N9J97_RS13225 (N9J97_13225) | 2754752..2755663 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
N9J97_RS13230 (N9J97_13230) | 2755660..2756352 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
N9J97_RS13235 (N9J97_13235) | 2756349..2756759 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
N9J97_RS13240 (N9J97_13240) | 2756772..2757131 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
N9J97_RS13245 (N9J97_13245) | 2757148..2757381 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
N9J97_RS13250 (N9J97_13250) | 2757378..2757761 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
N9J97_RS13255 (N9J97_13255) | 2757965..2758435 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
N9J97_RS13260 (N9J97_13260) | 2758432..2759007 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
N9J97_RS13265 (N9J97_13265) | 2759025..2759939 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
N9J97_RS13270 (N9J97_13270) | 2759936..2760406 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
N9J97_RS13275 (N9J97_13275) | 2760403..2760903 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
N9J97_RS13280 (N9J97_13280) | 2760903..2761805 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
N9J97_RS13285 (N9J97_13285) | 2761844..2762569 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2694593..2812312 | 117719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259800 WP_003153636.1 NZ_CP106784:2758432-2759007 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259800 WP_003050245.1 NZ_CP106784:2757965-2758435 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|