Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA(toxin) |
| Location | 1520002..1520950 | Replicon | chromosome |
| Accession | NZ_CP106784 | ||
| Organism | Pseudomonas aeruginosa strain NY5085 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8G3IXE4 |
| Locus tag | N9J97_RS07215 | Protein ID | WP_003098540.1 |
| Coordinates | 1520768..1520950 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N9J97_RS07210 | Protein ID | WP_228478067.1 |
| Coordinates | 1520002..1520721 (-) | Length | 240 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N9J97_RS07175 (N9J97_07175) | 1515310..1516065 | - | 756 | WP_034013778.1 | helix-turn-helix transcriptional regulator | - |
| N9J97_RS07180 (N9J97_07180) | 1516662..1517423 | + | 762 | WP_270105342.1 | helix-turn-helix domain-containing protein | - |
| N9J97_RS07185 (N9J97_07185) | 1517420..1518103 | + | 684 | WP_270105344.1 | replication protein P | - |
| N9J97_RS07190 (N9J97_07190) | 1518100..1518306 | + | 207 | WP_003159465.1 | hypothetical protein | - |
| N9J97_RS07195 (N9J97_07195) | 1518303..1518884 | + | 582 | WP_270105350.1 | recombination protein NinG | - |
| N9J97_RS07200 (N9J97_07200) | 1518881..1519177 | + | 297 | WP_114231220.1 | hypothetical protein | - |
| N9J97_RS07205 (N9J97_07205) | 1519215..1519889 | + | 675 | WP_021205614.1 | hypothetical protein | - |
| N9J97_RS07210 (N9J97_07210) | 1520002..1520721 | - | 720 | WP_228478067.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N9J97_RS07215 (N9J97_07215) | 1520768..1520950 | - | 183 | WP_003098540.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N9J97_RS07220 (N9J97_07220) | 1521166..1521687 | + | 522 | WP_158309806.1 | GspH/FimT family pseudopilin | - |
| N9J97_RS07225 (N9J97_07225) | 1521870..1522202 | + | 333 | WP_014602590.1 | phage holin, lambda family | - |
| N9J97_RS07230 (N9J97_07230) | 1522199..1522816 | + | 618 | WP_270105361.1 | glycoside hydrolase family 19 protein | - |
| N9J97_RS07235 (N9J97_07235) | 1522834..1523265 | + | 432 | WP_270105363.1 | hypothetical protein | - |
| N9J97_RS07240 (N9J97_07240) | 1523402..1523806 | + | 405 | WP_270105365.1 | HNH endonuclease | - |
| N9J97_RS07245 (N9J97_07245) | 1523888..1524370 | + | 483 | WP_073652361.1 | phage terminase small subunit P27 family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1498420..1570495 | 72075 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6746.86 Da Isoelectric Point: 11.0775
>T259798 WP_003098540.1 NZ_CP106784:c1520950-1520768 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
Download Length: 183 bp
Antitoxin
Download Length: 240 a.a. Molecular weight: 26723.27 Da Isoelectric Point: 5.1740
>AT259798 WP_228478067.1 NZ_CP106784:c1520721-1520002 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKTHAISEALDAIGTTLSLYIDARKSIPEATPPEEGEHVVHLPAVTVA
KIALWNEMMKRGMRKSDLCRLLGIAQTQGDRLVDFLHHTKMDAVESALLALGIRLRQSVEVRFDEVKLYLERDTTVVLSE
AWCELSASCKDEAGNYRGWLSLPSQTSPQRQTIKGIEAHRLASHCHLSISVDDDRPGEAPFESQGRIHLPVTFYSVEVK
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKTHAISEALDAIGTTLSLYIDARKSIPEATPPEEGEHVVHLPAVTVA
KIALWNEMMKRGMRKSDLCRLLGIAQTQGDRLVDFLHHTKMDAVESALLALGIRLRQSVEVRFDEVKLYLERDTTVVLSE
AWCELSASCKDEAGNYRGWLSLPSQTSPQRQTIKGIEAHRLASHCHLSISVDDDRPGEAPFESQGRIHLPVTFYSVEVK
Download Length: 720 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|