Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA(toxin)
Location 1520002..1520950 Replicon chromosome
Accession NZ_CP106784
Organism Pseudomonas aeruginosa strain NY5085

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag N9J97_RS07215 Protein ID WP_003098540.1
Coordinates 1520768..1520950 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N9J97_RS07210 Protein ID WP_228478067.1
Coordinates 1520002..1520721 (-) Length 240 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N9J97_RS07175 (N9J97_07175) 1515310..1516065 - 756 WP_034013778.1 helix-turn-helix transcriptional regulator -
N9J97_RS07180 (N9J97_07180) 1516662..1517423 + 762 WP_270105342.1 helix-turn-helix domain-containing protein -
N9J97_RS07185 (N9J97_07185) 1517420..1518103 + 684 WP_270105344.1 replication protein P -
N9J97_RS07190 (N9J97_07190) 1518100..1518306 + 207 WP_003159465.1 hypothetical protein -
N9J97_RS07195 (N9J97_07195) 1518303..1518884 + 582 WP_270105350.1 recombination protein NinG -
N9J97_RS07200 (N9J97_07200) 1518881..1519177 + 297 WP_114231220.1 hypothetical protein -
N9J97_RS07205 (N9J97_07205) 1519215..1519889 + 675 WP_021205614.1 hypothetical protein -
N9J97_RS07210 (N9J97_07210) 1520002..1520721 - 720 WP_228478067.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N9J97_RS07215 (N9J97_07215) 1520768..1520950 - 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
N9J97_RS07220 (N9J97_07220) 1521166..1521687 + 522 WP_158309806.1 GspH/FimT family pseudopilin -
N9J97_RS07225 (N9J97_07225) 1521870..1522202 + 333 WP_014602590.1 phage holin, lambda family -
N9J97_RS07230 (N9J97_07230) 1522199..1522816 + 618 WP_270105361.1 glycoside hydrolase family 19 protein -
N9J97_RS07235 (N9J97_07235) 1522834..1523265 + 432 WP_270105363.1 hypothetical protein -
N9J97_RS07240 (N9J97_07240) 1523402..1523806 + 405 WP_270105365.1 HNH endonuclease -
N9J97_RS07245 (N9J97_07245) 1523888..1524370 + 483 WP_073652361.1 phage terminase small subunit P27 family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1498420..1570495 72075


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T259798 WP_003098540.1 NZ_CP106784:c1520950-1520768 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 240 a.a.        Molecular weight: 26723.27 Da        Isoelectric Point: 5.1740

>AT259798 WP_228478067.1 NZ_CP106784:c1520721-1520002 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKTHAISEALDAIGTTLSLYIDARKSIPEATPPEEGEHVVHLPAVTVA
KIALWNEMMKRGMRKSDLCRLLGIAQTQGDRLVDFLHHTKMDAVESALLALGIRLRQSVEVRFDEVKLYLERDTTVVLSE
AWCELSASCKDEAGNYRGWLSLPSQTSPQRQTIKGIEAHRLASHCHLSISVDDDRPGEAPFESQGRIHLPVTFYSVEVK

Download         Length: 720 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References