Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141056..141561 | Replicon | chromosome |
Accession | NZ_CP106784 | ||
Organism | Pseudomonas aeruginosa strain NY5085 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | N9J97_RS00645 | Protein ID | WP_003121619.1 |
Coordinates | 141056..141337 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | N9J97_RS00650 | Protein ID | WP_003112628.1 |
Coordinates | 141334..141561 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9J97_RS00620 (N9J97_00620) | 136307..137656 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
N9J97_RS00625 (N9J97_00625) | 137705..138391 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
N9J97_RS00630 (N9J97_00630) | 138492..139226 | + | 735 | WP_003101224.1 | GntR family transcriptional regulator | - |
N9J97_RS00635 (N9J97_00635) | 139406..139816 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
N9J97_RS00640 (N9J97_00640) | 139848..140756 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
N9J97_RS00645 (N9J97_00645) | 141056..141337 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
N9J97_RS00650 (N9J97_00650) | 141334..141561 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
N9J97_RS00655 (N9J97_00655) | 141737..142357 | - | 621 | WP_003101226.1 | hypothetical protein | - |
N9J97_RS00660 (N9J97_00660) | 142458..142958 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
N9J97_RS00665 (N9J97_00665) | 143031..143372 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
N9J97_RS00670 (N9J97_00670) | 143454..144881 | - | 1428 | WP_003083784.1 | GABA permease | - |
N9J97_RS00675 (N9J97_00675) | 145050..146543 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T259797 WP_003121619.1 NZ_CP106784:c141337-141056 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6XRW | |
AlphaFold DB | Q9I707 |