Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1630528..1631213 | Replicon | chromosome |
| Accession | NZ_CP106782 | ||
| Organism | Neisseria gonorrhoeae strain 10795 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE27_RS08440 | Protein ID | WP_003689143.1 |
| Coordinates | 1631031..1631213 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE27_RS08435 | Protein ID | WP_003691454.1 |
| Coordinates | 1630528..1630929 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE27_RS08390 (LLE27_08390) | 1625943..1626125 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE27_RS08395 (LLE27_08395) | 1626265..1626951 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE27_RS08400 (LLE27_08400) | 1627020..1627181 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE27_RS08405 (LLE27_08405) | 1627178..1627456 | - | 279 | WP_229930232.1 | hypothetical protein | - |
| LLE27_RS08410 (LLE27_08410) | 1627609..1627941 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE27_RS08415 (LLE27_08415) | 1628082..1628246 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE27_RS08420 (LLE27_08420) | 1628487..1629248 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE27_RS08425 (LLE27_08425) | 1629337..1629753 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE27_RS08430 (LLE27_08430) | 1629762..1630397 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| LLE27_RS08435 (LLE27_08435) | 1630528..1630929 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE27_RS08440 (LLE27_08440) | 1631031..1631213 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE27_RS08445 (LLE27_08445) | 1631383..1632201 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE27_RS08450 (LLE27_08450) | 1632476..1633231 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE27_RS08455 (LLE27_08455) | 1633368..1633553 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE27_RS08460 (LLE27_08460) | 1633642..1633797 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE27_RS08465 (LLE27_08465) | 1633774..1633962 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE27_RS08470 (LLE27_08470) | 1634135..1634362 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE27_RS08475 (LLE27_08475) | 1634359..1634871 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE27_RS08480 (LLE27_08480) | 1634885..1635391 | + | 507 | WP_047920371.1 | hypothetical protein | - |
| LLE27_RS08485 (LLE27_08485) | 1635406..1636185 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1614959..1648298 | 33339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259796 WP_003689143.1 NZ_CP106782:c1631213-1631031 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259796 WP_003691454.1 NZ_CP106782:c1630929-1630528 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|