Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1630528..1631213 Replicon chromosome
Accession NZ_CP106782
Organism Neisseria gonorrhoeae strain 10795

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag LLE27_RS08440 Protein ID WP_003689143.1
Coordinates 1631031..1631213 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag LLE27_RS08435 Protein ID WP_003691454.1
Coordinates 1630528..1630929 (-) Length 134 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLE27_RS08390 (LLE27_08390) 1625943..1626125 - 183 WP_003691535.1 hypothetical protein -
LLE27_RS08395 (LLE27_08395) 1626265..1626951 - 687 WP_010357532.1 hypothetical protein -
LLE27_RS08400 (LLE27_08400) 1627020..1627181 - 162 WP_003693867.1 hypothetical protein -
LLE27_RS08405 (LLE27_08405) 1627178..1627456 - 279 WP_229930232.1 hypothetical protein -
LLE27_RS08410 (LLE27_08410) 1627609..1627941 - 333 WP_003695500.1 hypothetical protein -
LLE27_RS08415 (LLE27_08415) 1628082..1628246 - 165 WP_003700376.1 hypothetical protein -
LLE27_RS08420 (LLE27_08420) 1628487..1629248 + 762 WP_012503753.1 hypothetical protein -
LLE27_RS08425 (LLE27_08425) 1629337..1629753 - 417 WP_003700378.1 hypothetical protein -
LLE27_RS08430 (LLE27_08430) 1629762..1630397 - 636 WP_225602681.1 Panacea domain-containing protein -
LLE27_RS08435 (LLE27_08435) 1630528..1630929 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LLE27_RS08440 (LLE27_08440) 1631031..1631213 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
LLE27_RS08445 (LLE27_08445) 1631383..1632201 - 819 WP_003693474.1 DUF3037 domain-containing protein -
LLE27_RS08450 (LLE27_08450) 1632476..1633231 - 756 WP_003693472.1 LexA family transcriptional regulator -
LLE27_RS08455 (LLE27_08455) 1633368..1633553 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
LLE27_RS08460 (LLE27_08460) 1633642..1633797 + 156 WP_003698902.1 hypothetical protein -
LLE27_RS08465 (LLE27_08465) 1633774..1633962 - 189 WP_003691445.1 hypothetical protein -
LLE27_RS08470 (LLE27_08470) 1634135..1634362 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
LLE27_RS08475 (LLE27_08475) 1634359..1634871 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
LLE27_RS08480 (LLE27_08480) 1634885..1635391 + 507 WP_047920371.1 hypothetical protein -
LLE27_RS08485 (LLE27_08485) 1635406..1636185 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1614959..1648298 33339


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259796 WP_003689143.1 NZ_CP106782:c1631213-1631031 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp


Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259796 WP_003691454.1 NZ_CP106782:c1630929-1630528 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q5F6D1


Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References