Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 951141..951796 | Replicon | chromosome |
| Accession | NZ_CP106782 | ||
| Organism | Neisseria gonorrhoeae strain 10795 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | LLE27_RS04895 | Protein ID | WP_003691083.1 |
| Coordinates | 951141..951560 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | LLE27_RS04900 | Protein ID | WP_003688410.1 |
| Coordinates | 951560..951796 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE27_RS04875 (LLE27_04875) | 946375..947916 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
| LLE27_RS04880 (LLE27_04880) | 948064..948843 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| LLE27_RS04885 (LLE27_04885) | 948840..949541 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| LLE27_RS04890 (LLE27_04890) | 949538..950992 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| LLE27_RS04895 (LLE27_04895) | 951141..951560 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| LLE27_RS04900 (LLE27_04900) | 951560..951796 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| LLE27_RS04905 (LLE27_04905) | 952243..952821 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
| LLE27_RS04910 (LLE27_04910) | 952826..953116 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
| LLE27_RS04915 (LLE27_04915) | 953466..953852 | + | 387 | Protein_965 | transposase | - |
| LLE27_RS04920 (LLE27_04920) | 954235..955125 | - | 891 | WP_229930257.1 | succinate--CoA ligase subunit alpha | - |
| LLE27_RS04925 (LLE27_04925) | 955136..956302 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| LLE27_RS04930 (LLE27_04930) | 956374..956661 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259795 WP_003691083.1 NZ_CP106782:c951560-951141 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|