Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1631161..1631846 | Replicon | chromosome |
| Accession | NZ_CP106780 | ||
| Organism | Neisseria gonorrhoeae strain 10794 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE29_RS08480 | Protein ID | WP_003689143.1 |
| Coordinates | 1631664..1631846 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE29_RS08475 | Protein ID | WP_003691454.1 |
| Coordinates | 1631161..1631562 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE29_RS08430 (LLE29_08430) | 1626576..1626758 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE29_RS08435 (LLE29_08435) | 1626898..1627584 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| LLE29_RS08440 (LLE29_08440) | 1627653..1627814 | - | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE29_RS08445 (LLE29_08445) | 1627811..1628089 | - | 279 | WP_041421244.1 | hypothetical protein | - |
| LLE29_RS08450 (LLE29_08450) | 1628242..1628574 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE29_RS08455 (LLE29_08455) | 1628715..1628879 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE29_RS08460 (LLE29_08460) | 1629120..1629881 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE29_RS08465 (LLE29_08465) | 1629970..1630386 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE29_RS08470 (LLE29_08470) | 1630395..1631030 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| LLE29_RS08475 (LLE29_08475) | 1631161..1631562 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE29_RS08480 (LLE29_08480) | 1631664..1631846 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE29_RS08485 (LLE29_08485) | 1632016..1632834 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE29_RS08490 (LLE29_08490) | 1633109..1633864 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE29_RS08495 (LLE29_08495) | 1634001..1634186 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE29_RS08500 (LLE29_08500) | 1634275..1634430 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE29_RS08505 (LLE29_08505) | 1634407..1634595 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE29_RS08510 (LLE29_08510) | 1634768..1634995 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE29_RS08515 (LLE29_08515) | 1634992..1635504 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE29_RS08520 (LLE29_08520) | 1635518..1636036 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| LLE29_RS08525 (LLE29_08525) | 1636051..1636830 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1615593..1648942 | 33349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259794 WP_003689143.1 NZ_CP106780:c1631846-1631664 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259794 WP_003691454.1 NZ_CP106780:c1631562-1631161 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|