Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 951930..952585 | Replicon | chromosome |
Accession | NZ_CP106780 | ||
Organism | Neisseria gonorrhoeae strain 10794 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | LLE29_RS04940 | Protein ID | WP_003691083.1 |
Coordinates | 951930..952349 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | LLE29_RS04945 | Protein ID | WP_003688410.1 |
Coordinates | 952349..952585 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLE29_RS04920 (LLE29_04920) | 947164..948705 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
LLE29_RS04925 (LLE29_04925) | 948853..949632 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
LLE29_RS04930 (LLE29_04930) | 949629..950330 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
LLE29_RS04935 (LLE29_04935) | 950327..951781 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
LLE29_RS04940 (LLE29_04940) | 951930..952349 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
LLE29_RS04945 (LLE29_04945) | 952349..952585 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
LLE29_RS04950 (LLE29_04950) | 953032..953610 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
LLE29_RS04955 (LLE29_04955) | 953615..953905 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
LLE29_RS04960 (LLE29_04960) | 954255..954641 | + | 387 | Protein_974 | transposase | - |
LLE29_RS04965 (LLE29_04965) | 955024..955914 | - | 891 | WP_229930257.1 | succinate--CoA ligase subunit alpha | - |
LLE29_RS04970 (LLE29_04970) | 955925..957091 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
LLE29_RS04975 (LLE29_04975) | 957163..957450 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259793 WP_003691083.1 NZ_CP106780:c952349-951930 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|