Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1653869..1654554 | Replicon | chromosome |
| Accession | NZ_CP106775 | ||
| Organism | Neisseria gonorrhoeae strain 10702 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE32_RS08620 | Protein ID | WP_003689143.1 |
| Coordinates | 1654372..1654554 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE32_RS08615 | Protein ID | WP_003691454.1 |
| Coordinates | 1653869..1654270 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE32_RS08570 (LLE32_08570) | 1649287..1649469 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE32_RS08575 (LLE32_08575) | 1649609..1650295 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE32_RS08580 (LLE32_08580) | 1650364..1650525 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE32_RS08585 (LLE32_08585) | 1650522..1650797 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| LLE32_RS08590 (LLE32_08590) | 1650950..1651282 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE32_RS08595 (LLE32_08595) | 1651423..1651587 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE32_RS08600 (LLE32_08600) | 1651828..1652589 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE32_RS08605 (LLE32_08605) | 1652678..1653094 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE32_RS08610 (LLE32_08610) | 1653103..1653738 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| LLE32_RS08615 (LLE32_08615) | 1653869..1654270 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE32_RS08620 (LLE32_08620) | 1654372..1654554 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE32_RS08625 (LLE32_08625) | 1654724..1655542 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE32_RS08630 (LLE32_08630) | 1655817..1656572 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE32_RS08635 (LLE32_08635) | 1656709..1656894 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE32_RS08640 (LLE32_08640) | 1656983..1657138 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE32_RS08645 (LLE32_08645) | 1657115..1657303 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE32_RS08650 (LLE32_08650) | 1657476..1657703 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE32_RS08655 (LLE32_08655) | 1657700..1658167 | + | 468 | WP_229433445.1 | helix-turn-helix domain-containing protein | - |
| LLE32_RS08660 (LLE32_08660) | 1658181..1658687 | + | 507 | WP_047920371.1 | hypothetical protein | - |
| LLE32_RS08665 (LLE32_08665) | 1658702..1659481 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1637542..1671850 | 34308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259789 WP_003689143.1 NZ_CP106775:c1654554-1654372 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259789 WP_003691454.1 NZ_CP106775:c1654270-1653869 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|