Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 950470..951125 | Replicon | chromosome |
| Accession | NZ_CP106775 | ||
| Organism | Neisseria gonorrhoeae strain 10702 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | LLE32_RS04920 | Protein ID | WP_003691083.1 |
| Coordinates | 950470..950889 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | LLE32_RS04925 | Protein ID | WP_003688410.1 |
| Coordinates | 950889..951125 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE32_RS04900 (LLE32_04900) | 945704..947245 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
| LLE32_RS04905 (LLE32_04905) | 947393..948172 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| LLE32_RS04910 (LLE32_04910) | 948169..948870 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
| LLE32_RS04915 (LLE32_04915) | 948867..950321 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| LLE32_RS04920 (LLE32_04920) | 950470..950889 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| LLE32_RS04925 (LLE32_04925) | 950889..951125 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| LLE32_RS04930 (LLE32_04930) | 951572..952150 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
| LLE32_RS04935 (LLE32_04935) | 952155..952445 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
| LLE32_RS04940 (LLE32_04940) | 952795..953181 | + | 387 | Protein_970 | transposase | - |
| LLE32_RS04945 (LLE32_04945) | 953564..954454 | - | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
| LLE32_RS04950 (LLE32_04950) | 954465..955631 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| LLE32_RS04955 (LLE32_04955) | 955703..955990 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259788 WP_003691083.1 NZ_CP106775:c950889-950470 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|