Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1640852..1641537 Replicon chromosome
Accession NZ_CP106773
Organism Neisseria gonorrhoeae strain 10562

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag LLE35_RS08605 Protein ID WP_003689143.1
Coordinates 1641355..1641537 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag LLE35_RS08600 Protein ID WP_003691454.1
Coordinates 1640852..1641253 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLE35_RS08560 (LLE35_08505) 1636270..1636452 - 183 WP_003691535.1 hypothetical protein -
LLE35_RS08565 (LLE35_08510) 1636592..1637278 - 687 WP_010357532.1 hypothetical protein -
LLE35_RS08570 (LLE35_08515) 1637347..1637508 - 162 WP_003691530.1 hypothetical protein -
LLE35_RS08575 (LLE35_08520) 1637505..1637780 - 276 WP_033911205.1 hypothetical protein -
LLE35_RS08580 (LLE35_08525) 1637933..1638265 - 333 WP_003695500.1 hypothetical protein -
LLE35_RS08585 (LLE35_08530) 1638811..1639572 + 762 WP_012503753.1 hypothetical protein -
LLE35_RS08590 (LLE35_08535) 1639661..1640077 - 417 WP_003700378.1 hypothetical protein -
LLE35_RS08595 (LLE35_08540) 1640086..1640670 - 585 WP_003693477.1 Panacea domain-containing protein -
LLE35_RS08600 (LLE35_08545) 1640852..1641253 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LLE35_RS08605 (LLE35_08550) 1641355..1641537 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
LLE35_RS08610 (LLE35_08555) 1641707..1642525 - 819 WP_003693474.1 DUF3037 domain-containing protein -
LLE35_RS08615 (LLE35_08560) 1642800..1643555 - 756 WP_003693472.1 LexA family transcriptional regulator -
LLE35_RS08620 (LLE35_08565) 1643692..1643877 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
LLE35_RS08625 (LLE35_08570) 1643966..1644121 + 156 WP_003698902.1 hypothetical protein -
LLE35_RS08630 (LLE35_08575) 1644098..1644286 - 189 WP_003691445.1 hypothetical protein -
LLE35_RS08635 (LLE35_08580) 1644459..1644686 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
LLE35_RS08640 (LLE35_08585) 1644683..1645150 + 468 WP_229433445.1 helix-turn-helix domain-containing protein -
LLE35_RS08645 (LLE35_08590) 1645164..1645694 + 531 WP_229931507.1 hypothetical protein -
LLE35_RS08650 (LLE35_08595) 1645709..1646488 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1624525..1658990 34465


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259786 WP_003689143.1 NZ_CP106773:c1641537-1641355 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259786 WP_003691454.1 NZ_CP106773:c1641253-1640852 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References