Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 657525..658180 | Replicon | chromosome |
| Accession | NZ_CP106773 | ||
| Organism | Neisseria gonorrhoeae strain 10562 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LLE35_RS03545 | Protein ID | WP_229931500.1 |
| Coordinates | 657761..658180 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | LLE35_RS03540 | Protein ID | WP_003688410.1 |
| Coordinates | 657525..657761 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE35_RS03510 (LLE35_03495) | 652660..652947 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| LLE35_RS03515 (LLE35_03500) | 653019..654185 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| LLE35_RS03520 (LLE35_03505) | 654196..655086 | + | 891 | WP_229931474.1 | succinate--CoA ligase subunit alpha | - |
| LLE35_RS03525 (LLE35_03510) | 655469..655855 | - | 387 | Protein_688 | transposase | - |
| LLE35_RS03530 (LLE35_03515) | 656094..656495 | + | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
| LLE35_RS03535 (LLE35_03520) | 656500..657078 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
| LLE35_RS03540 (LLE35_03525) | 657525..657761 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| LLE35_RS03545 (LLE35_03530) | 657761..658180 | + | 420 | WP_229931500.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| LLE35_RS03550 (LLE35_03535) | 658329..659783 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| LLE35_RS03555 (LLE35_03540) | 659780..660481 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| LLE35_RS03560 (LLE35_03545) | 660478..661257 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| LLE35_RS03565 (LLE35_03550) | 661405..662946 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15336.67 Da Isoelectric Point: 5.5742
>T259785 WP_229931500.1 NZ_CP106773:657761-658180 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGWILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|