Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1658524..1659209 Replicon chromosome
Accession NZ_CP106771
Organism Neisseria gonorrhoeae strain 10531

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag LLE28_RS08620 Protein ID WP_003689143.1
Coordinates 1659027..1659209 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag LLE28_RS08615 Protein ID WP_003691454.1
Coordinates 1658524..1658925 (-) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LLE28_RS08570 1653942..1654124 - 183 WP_003691535.1 hypothetical protein -
LLE28_RS08575 1654264..1654950 - 687 WP_010357532.1 hypothetical protein -
LLE28_RS08580 1655019..1655180 - 162 WP_003691530.1 hypothetical protein -
LLE28_RS08585 1655177..1655452 - 276 WP_033911205.1 hypothetical protein -
LLE28_RS08590 1655605..1655937 - 333 WP_003695500.1 hypothetical protein -
LLE28_RS08595 1656078..1656242 - 165 WP_003700376.1 hypothetical protein -
LLE28_RS08600 1656483..1657244 + 762 WP_012503753.1 hypothetical protein -
LLE28_RS08605 1657333..1657749 - 417 WP_003700378.1 hypothetical protein -
LLE28_RS08610 1657758..1658393 - 636 WP_225602681.1 Panacea domain-containing protein -
LLE28_RS08615 1658524..1658925 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
LLE28_RS08620 1659027..1659209 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
LLE28_RS08625 1659379..1660197 - 819 WP_003693474.1 DUF3037 domain-containing protein -
LLE28_RS08630 1660472..1661227 - 756 WP_003693472.1 LexA family transcriptional regulator -
LLE28_RS08635 1661364..1661549 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
LLE28_RS08640 1661638..1661793 + 156 WP_003698902.1 hypothetical protein -
LLE28_RS08645 1661770..1661958 - 189 WP_003691445.1 hypothetical protein -
LLE28_RS08650 1662131..1662358 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
LLE28_RS08655 1662355..1662867 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
LLE28_RS08660 1662881..1663399 + 519 WP_025456213.1 hypothetical protein -
LLE28_RS08665 1663414..1664193 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1642197..1676640 34443


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T259784 WP_003689143.1 NZ_CP106771:c1659209-1659027 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT259784 WP_003691454.1 NZ_CP106771:c1658925-1658524 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q5F6D1

Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References