Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 652432..653087 | Replicon | chromosome |
Accession | NZ_CP106771 | ||
Organism | Neisseria gonorrhoeae strain 10531 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | LLE28_RS03505 | Protein ID | WP_003691083.1 |
Coordinates | 652668..653087 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | LLE28_RS03500 | Protein ID | WP_003688410.1 |
Coordinates | 652432..652668 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLE28_RS03470 | 647567..647854 | + | 288 | WP_003688407.1 | hypothetical protein | - |
LLE28_RS03475 | 647926..649092 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
LLE28_RS03480 | 649103..649993 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
LLE28_RS03485 | 650376..650762 | - | 387 | Protein_680 | transposase | - |
LLE28_RS03490 | 651112..651402 | + | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
LLE28_RS03495 | 651407..651985 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
LLE28_RS03500 | 652432..652668 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
LLE28_RS03505 | 652668..653087 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
LLE28_RS03510 | 653236..654690 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
LLE28_RS03515 | 654687..655388 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
LLE28_RS03520 | 655385..656164 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
LLE28_RS03525 | 656312..657853 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259783 WP_003691083.1 NZ_CP106771:652668-653087 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|