Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1651028..1651713 | Replicon | chromosome |
| Accession | NZ_CP106769 | ||
| Organism | Neisseria gonorrhoeae strain 10524 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE34_RS08635 | Protein ID | WP_003689143.1 |
| Coordinates | 1651531..1651713 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE34_RS08630 | Protein ID | WP_003691454.1 |
| Coordinates | 1651028..1651429 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE34_RS08585 (LLE34_08585) | 1646446..1646628 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE34_RS08590 (LLE34_08590) | 1646768..1647454 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE34_RS08595 (LLE34_08595) | 1647523..1647684 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE34_RS08600 (LLE34_08600) | 1647681..1647956 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| LLE34_RS08605 (LLE34_08605) | 1648109..1648441 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE34_RS08610 (LLE34_08610) | 1648582..1648746 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE34_RS08615 (LLE34_08615) | 1648987..1649748 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE34_RS08620 (LLE34_08620) | 1649837..1650253 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| LLE34_RS08625 (LLE34_08625) | 1650262..1650846 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| LLE34_RS08630 (LLE34_08630) | 1651028..1651429 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE34_RS08635 (LLE34_08635) | 1651531..1651713 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE34_RS08640 (LLE34_08640) | 1651883..1652701 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE34_RS08645 (LLE34_08645) | 1652976..1653731 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE34_RS08650 (LLE34_08650) | 1653868..1654053 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE34_RS08655 (LLE34_08655) | 1654142..1654297 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE34_RS08660 (LLE34_08660) | 1654274..1654462 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE34_RS08665 (LLE34_08665) | 1654635..1654862 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| LLE34_RS08670 (LLE34_08670) | 1654859..1655371 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE34_RS08675 (LLE34_08675) | 1655385..1655903 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| LLE34_RS08680 (LLE34_08680) | 1655918..1656697 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1634701..1669144 | 34443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259781 WP_003689143.1 NZ_CP106769:c1651713-1651531 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259781 WP_003691454.1 NZ_CP106769:c1651429-1651028 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|