Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1522076..1522761 | Replicon | chromosome |
| Accession | NZ_CP106767 | ||
| Organism | Neisseria gonorrhoeae strain 10610 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | LLE33_RS07965 | Protein ID | WP_003689143.1 |
| Coordinates | 1522579..1522761 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | LLE33_RS07960 | Protein ID | WP_003691454.1 |
| Coordinates | 1522076..1522477 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE33_RS07915 (LLE33_07915) | 1517494..1517676 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE33_RS07920 (LLE33_07920) | 1517816..1518502 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| LLE33_RS07925 (LLE33_07925) | 1518571..1518732 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE33_RS07930 (LLE33_07930) | 1518729..1519004 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| LLE33_RS07935 (LLE33_07935) | 1519157..1519489 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE33_RS07940 (LLE33_07940) | 1519630..1519794 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| LLE33_RS07945 (LLE33_07945) | 1520035..1520796 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE33_RS07950 (LLE33_07950) | 1520885..1521229 | - | 345 | WP_229931773.1 | hypothetical protein | - |
| LLE33_RS07955 (LLE33_07955) | 1521310..1521894 | - | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| LLE33_RS07960 (LLE33_07960) | 1522076..1522477 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| LLE33_RS07965 (LLE33_07965) | 1522579..1522761 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| LLE33_RS07970 (LLE33_07970) | 1522931..1523749 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE33_RS07975 (LLE33_07975) | 1524024..1524779 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE33_RS07980 (LLE33_07980) | 1524916..1525101 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE33_RS07985 (LLE33_07985) | 1525190..1525345 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE33_RS07990 (LLE33_07990) | 1525322..1525510 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE33_RS07995 (LLE33_07995) | 1525683..1525910 | + | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| LLE33_RS08000 (LLE33_08000) | 1525907..1526419 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| LLE33_RS08005 (LLE33_08005) | 1526433..1526951 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| LLE33_RS08010 (LLE33_08010) | 1526966..1527745 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1508217..1541502 | 33285 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T259778 WP_003689143.1 NZ_CP106767:c1522761-1522579 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT259778 WP_003691454.1 NZ_CP106767:c1522477-1522076 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|