Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 652150..652805 | Replicon | chromosome |
Accession | NZ_CP106767 | ||
Organism | Neisseria gonorrhoeae strain 10610 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | LLE33_RS03485 | Protein ID | WP_003691083.1 |
Coordinates | 652386..652805 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | LLE33_RS03480 | Protein ID | WP_003688410.1 |
Coordinates | 652150..652386 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LLE33_RS03450 (LLE33_03450) | 647285..647572 | + | 288 | WP_003688407.1 | hypothetical protein | - |
LLE33_RS03455 (LLE33_03455) | 647644..648810 | + | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
LLE33_RS03460 (LLE33_03460) | 648821..649711 | + | 891 | WP_003693285.1 | succinate--CoA ligase subunit alpha | - |
LLE33_RS03465 (LLE33_03465) | 650094..650480 | - | 387 | Protein_676 | transposase | - |
LLE33_RS03470 (LLE33_03470) | 650719..651120 | + | 402 | WP_020996834.1 | helix-turn-helix domain-containing protein | - |
LLE33_RS03475 (LLE33_03475) | 651125..651703 | + | 579 | WP_003697246.1 | IS3 family transposase | - |
LLE33_RS03480 (LLE33_03480) | 652150..652386 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
LLE33_RS03485 (LLE33_03485) | 652386..652805 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
LLE33_RS03490 (LLE33_03490) | 652954..654408 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
LLE33_RS03495 (LLE33_03495) | 654405..655106 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
LLE33_RS03500 (LLE33_03500) | 655103..655882 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
LLE33_RS03505 (LLE33_03505) | 656030..657571 | + | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T259777 WP_003691083.1 NZ_CP106767:652386-652805 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|