Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 170346..171256 Replicon plasmid pKP0937-1
Accession NZ_CP106761
Organism Klebsiella pneumoniae strain KP0937

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag N8627_RS27820 Protein ID WP_004026354.1
Coordinates 170346..170816 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag N8627_RS27825 Protein ID WP_004026357.1
Coordinates 170813..171256 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8627_RS27780 (N8627_27780) 165662..165976 + 315 WP_011251273.1 hypothetical protein -
N8627_RS27785 (N8627_27785) 165985..166479 + 495 WP_011251274.1 hypothetical protein -
N8627_RS27790 (N8627_27790) 166485..166925 + 441 WP_011251275.1 hypothetical protein -
N8627_RS27795 (N8627_27795) 167350..168306 - 957 WP_011251280.1 DsbA family protein -
N8627_RS27800 (N8627_27800) 168366..168707 - 342 WP_011251281.1 hypothetical protein -
N8627_RS27805 (N8627_27805) 168721..169032 - 312 WP_011251282.1 hypothetical protein -
N8627_RS27810 (N8627_27810) 169049..169498 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
N8627_RS27820 (N8627_27820) 170346..170816 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
N8627_RS27825 (N8627_27825) 170813..171256 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
N8627_RS27830 (N8627_27830) 171357..171860 - 504 Protein_190 DUF4113 domain-containing protein -
N8627_RS27835 (N8627_27835) 172066..173046 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
N8627_RS27840 (N8627_27840) 173112..174419 + 1308 Protein_192 FepA family TonB-dependent siderophore receptor -
N8627_RS27845 (N8627_27845) 174481..174702 + 222 WP_004213615.1 hypothetical protein -
N8627_RS27850 (N8627_27850) 175046..176008 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA2 / iroN 1..190869 190869
- inside IScluster/Tn - iroN 164065..177657 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T259766 WP_004026354.1 NZ_CP106761:c170816-170346 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT259766 WP_004026357.1 NZ_CP106761:c171256-170813 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References