Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 107857..108500 Replicon plasmid pKP0937-1
Accession NZ_CP106761
Organism Klebsiella pneumoniae strain KP0937

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag N8627_RS27470 Protein ID WP_001044770.1
Coordinates 108084..108500 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag N8627_RS27465 Protein ID WP_001261282.1
Coordinates 107857..108087 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8627_RS27440 (N8627_27440) 103797..103964 - 168 Protein_112 IS1 family transposase -
N8627_RS27445 (N8627_27445) 104268..105197 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
N8627_RS27450 (N8627_27450) 105342..106121 - 780 WP_004213560.1 site-specific integrase -
N8627_RS27455 (N8627_27455) 106118..106939 - 822 WP_004213562.1 hypothetical protein -
N8627_RS27460 (N8627_27460) 107439..107900 - 462 WP_263096524.1 hypothetical protein -
N8627_RS27465 (N8627_27465) 107857..108087 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N8627_RS27470 (N8627_27470) 108084..108500 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
N8627_RS27475 (N8627_27475) 108621..109318 + 698 WP_223174630.1 IS1 family transposase -
N8627_RS27480 (N8627_27480) 109347..109619 + 273 Protein_120 transposase -
N8627_RS27485 (N8627_27485) 109899..110903 - 1005 WP_000427619.1 IS110-like element IS5075 family transposase -
N8627_RS27490 (N8627_27490) 110994..111428 - 435 WP_000405672.1 Cd(II)/Pb(II)-responsive transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA2 / iroN 1..190869 190869
- inside IScluster/Tn - - 108941..133964 25023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T259764 WP_001044770.1 NZ_CP106761:108084-108500 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT259764 WP_001261282.1 NZ_CP106761:107857-108087 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References