Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 13156..13826 Replicon plasmid pKP0937-1
Accession NZ_CP106761
Organism Klebsiella pneumoniae strain KP0937

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag N8627_RS26955 Protein ID WP_004213072.1
Coordinates 13156..13599 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag N8627_RS26960 Protein ID WP_004213073.1
Coordinates 13596..13826 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8627_RS26920 (N8627_26920) 8567..8842 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
N8627_RS26925 (N8627_26925) 8905..9396 + 492 WP_011251327.1 DM13 domain-containing protein -
N8627_RS26930 (N8627_26930) 9445..10365 + 921 WP_004213934.1 DUF1471 domain-containing protein -
N8627_RS26935 (N8627_26935) 10456..10859 + 404 Protein_11 GAF domain-containing protein -
N8627_RS26940 (N8627_26940) 11377..12012 - 636 Protein_12 mucoid phenotype regulator RmpA2 -
N8627_RS26945 (N8627_26945) 12429..12733 + 305 Protein_13 transposase -
N8627_RS26950 (N8627_26950) 12756..13007 - 252 WP_186987481.1 hypothetical protein -
N8627_RS26955 (N8627_26955) 13156..13599 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
N8627_RS26960 (N8627_26960) 13596..13826 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N8627_RS26965 (N8627_26965) 14434..15567 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
N8627_RS26970 (N8627_26970) 15583..15876 + 294 WP_004213076.1 hypothetical protein -
N8627_RS26975 (N8627_26975) 15866..16072 - 207 WP_004213077.1 hypothetical protein -
N8627_RS26980 (N8627_26980) 16424..16714 + 291 WP_004213078.1 hypothetical protein -
N8627_RS26985 (N8627_26985) 16704..17603 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA2 / iroN 1..190869 190869


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T259763 WP_004213072.1 NZ_CP106761:c13599-13156 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT259763 WP_004213073.1 NZ_CP106761:c13826-13596 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References