Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4163624..4164243 Replicon chromosome
Accession NZ_CP106760
Organism Klebsiella pneumoniae strain KP0937

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N8627_RS20715 Protein ID WP_002892050.1
Coordinates 4164025..4164243 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N8627_RS20710 Protein ID WP_002892066.1
Coordinates 4163624..4163998 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8627_RS20700 (N8627_20700) 4158776..4159969 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N8627_RS20705 (N8627_20705) 4159992..4163138 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
N8627_RS20710 (N8627_20710) 4163624..4163998 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N8627_RS20715 (N8627_20715) 4164025..4164243 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N8627_RS20720 (N8627_20720) 4164402..4164968 + 567 WP_002892030.1 maltose O-acetyltransferase -
N8627_RS20725 (N8627_20725) 4164940..4165080 - 141 WP_004147370.1 hypothetical protein -
N8627_RS20730 (N8627_20730) 4165101..4165571 + 471 WP_002892026.1 YlaC family protein -
N8627_RS20735 (N8627_20735) 4165546..4166997 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N8627_RS20740 (N8627_20740) 4167098..4167796 + 699 WP_002892021.1 GNAT family protein -
N8627_RS20745 (N8627_20745) 4167793..4167933 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N8627_RS20750 (N8627_20750) 4167933..4168196 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259758 WP_002892050.1 NZ_CP106760:4164025-4164243 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259758 WP_002892066.1 NZ_CP106760:4163624-4163998 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References