Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3340384..3341015 | Replicon | chromosome |
| Accession | NZ_CP106760 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | N8627_RS16760 | Protein ID | WP_012542177.1 |
| Coordinates | 3340839..3341015 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | N8627_RS16755 | Protein ID | WP_017898984.1 |
| Coordinates | 3340384..3340791 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS16720 (N8627_16720) | 3335748..3336182 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
| N8627_RS16725 (N8627_16725) | 3336430..3336861 | - | 432 | WP_023279521.1 | hypothetical protein | - |
| N8627_RS16730 (N8627_16730) | 3336858..3337175 | - | 318 | WP_023279522.1 | hypothetical protein | - |
| N8627_RS16735 (N8627_16735) | 3337127..3337489 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
| N8627_RS16740 (N8627_16740) | 3338614..3338964 | - | 351 | WP_017898986.1 | hypothetical protein | - |
| N8627_RS16745 (N8627_16745) | 3338961..3339458 | - | 498 | WP_023279523.1 | lysozyme | - |
| N8627_RS16750 (N8627_16750) | 3339458..3339673 | - | 216 | WP_017880269.1 | class II holin family protein | - |
| N8627_RS16755 (N8627_16755) | 3340384..3340791 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N8627_RS16760 (N8627_16760) | 3340839..3341015 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N8627_RS16765 (N8627_16765) | 3341379..3343163 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
| N8627_RS16770 (N8627_16770) | 3343183..3344217 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
| N8627_RS16775 (N8627_16775) | 3344242..3344583 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
| N8627_RS16780 (N8627_16780) | 3344596..3345627 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3306915..3364426 | 57511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T259757 WP_012542177.1 NZ_CP106760:c3341015-3340839 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT259757 WP_017898984.1 NZ_CP106760:c3340791-3340384 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |