Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 7322..7893 Replicon plasmid pNY13410
Accession NZ_CP106758
Organism Enterococcus faecalis strain NY13410

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag N8I78_RS14500 Protein ID WP_002362432.1
Coordinates 7552..7893 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag N8I78_RS14495 Protein ID WP_002362431.1
Coordinates 7322..7552 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8I78_RS14440 (N8I78_14440) 2882..3178 - 297 WP_002367795.1 hypothetical protein -
N8I78_RS14445 (N8I78_14445) 3435..3521 - 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
N8I78_RS14450 (N8I78_14450) 3613..3828 - 216 WP_002415356.1 hypothetical protein -
N8I78_RS14455 (N8I78_14455) 3776..4294 - 519 WP_002367793.1 hypothetical protein -
N8I78_RS14460 (N8I78_14460) 4710..5051 - 342 WP_002367792.1 bacteriocin immunity protein -
N8I78_RS14465 (N8I78_14465) 5052..5267 - 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
N8I78_RS14470 (N8I78_14470) 5437..5628 - 192 WP_002367788.1 hypothetical protein -
N8I78_RS14475 (N8I78_14475) 5640..5834 - 195 WP_002367787.1 hypothetical protein -
N8I78_RS14480 (N8I78_14480) 5994..6200 - 207 WP_002367786.1 hypothetical protein -
N8I78_RS14485 (N8I78_14485) 6194..6508 - 315 WP_002367785.1 hypothetical protein -
N8I78_RS14490 (N8I78_14490) 6498..7118 - 621 WP_002367784.1 recombinase family protein -
N8I78_RS14495 (N8I78_14495) 7322..7552 + 231 WP_002362431.1 hypothetical protein Antitoxin
N8I78_RS14500 (N8I78_14500) 7552..7893 + 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
N8I78_RS14505 (N8I78_14505) 8005..8943 + 939 WP_002362433.1 hypothetical protein -
N8I78_RS14510 (N8I78_14510) 9208..9810 + 603 WP_002362434.1 Fic family protein -
N8I78_RS14515 (N8I78_14515) 9949..11072 + 1124 WP_154805971.1 IS3 family transposase -
N8I78_RS14520 (N8I78_14520) 11210..12493 + 1284 WP_242900418.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid str / cat / tet(M) / tet(L) - 1..65086 65086


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T259747 WP_002362432.1 NZ_CP106758:7552-7893 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT259747 WP_002362431.1 NZ_CP106758:7322-7552 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References