Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4033311..4034146 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | N8153_RS19640 | Protein ID | WP_001094448.1 |
| Coordinates | 4033769..4034146 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | N8153_RS19635 | Protein ID | WP_115914908.1 |
| Coordinates | 4033311..4033679 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS19610 (4028372) | 4028372..4030732 | + | 2361 | Protein_3815 | Ag43/Cah family autotransporter adhesin | - |
| N8153_RS19615 (4031060) | 4031060..4031878 | + | 819 | WP_072643846.1 | DUF932 domain-containing protein | - |
| N8153_RS19620 (4031970) | 4031970..4032455 | + | 486 | WP_000214415.1 | antirestriction protein | - |
| N8153_RS19625 (4032471) | 4032471..4032947 | + | 477 | WP_001186725.1 | RadC family protein | - |
| N8153_RS19630 (4033016) | 4033016..4033237 | + | 222 | WP_073544043.1 | DUF987 domain-containing protein | - |
| N8153_RS19635 (4033311) | 4033311..4033679 | + | 369 | WP_115914908.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| N8153_RS19640 (4033769) | 4033769..4034146 | + | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| N8153_RS19645 (4034143) | 4034143..4034631 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| N8153_RS19650 (4034643) | 4034643..4034840 | + | 198 | WP_001737717.1 | DUF957 domain-containing protein | - |
| N8153_RS19655 (4034925) | 4034925..4035770 | + | 846 | Protein_3824 | DUF4942 domain-containing protein | - |
| N8153_RS19660 (4035841) | 4035841..4037376 | + | 1536 | WP_021571439.1 | EAL domain-containing protein | - |
| N8153_RS19665 (4037773) | 4037773..4037994 | + | 222 | Protein_3826 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T259725 WP_001094448.1 NZ_CP106756:4033769-4034146 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13572.36 Da Isoelectric Point: 6.2044
>AT259725 WP_115914908.1 NZ_CP106756:4033311-4033679 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|