Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3922384..3923038 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A140N853 |
| Locus tag | N8153_RS19085 | Protein ID | WP_000244783.1 |
| Coordinates | 3922384..3922791 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N8153_RS19090 | Protein ID | WP_000354046.1 |
| Coordinates | 3922772..3923038 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS19065 (3918341) | 3918341..3920074 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N8153_RS19070 (3920080) | 3920080..3920790 | - | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N8153_RS19075 (3920815) | 3920815..3921711 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N8153_RS19080 (3921823) | 3921823..3922344 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N8153_RS19085 (3922384) | 3922384..3922791 | - | 408 | WP_000244783.1 | protein YgfX | Toxin |
| N8153_RS19090 (3922772) | 3922772..3923038 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N8153_RS19095 (3923281) | 3923281..3924261 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| N8153_RS19100 (3924457) | 3924457..3925116 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N8153_RS19105 (3925280) | 3925280..3925591 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| N8153_RS19110 (3925636) | 3925636..3927069 | + | 1434 | WP_263082296.1 | 6-phospho-beta-glucosidase BglA | - |
| N8153_RS19115 (3927126) | 3927126..3927869 | - | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15962.85 Da Isoelectric Point: 11.2669
>T259724 WP_000244783.1 NZ_CP106756:c3922791-3922384 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140N853 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |