Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 3796676..3797259 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A1V3W215 |
| Locus tag | N8153_RS18565 | Protein ID | WP_000254741.1 |
| Coordinates | 3796676..3797011 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | N8153_RS18570 | Protein ID | WP_000581937.1 |
| Coordinates | 3797011..3797259 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS18550 (3792563) | 3792563..3793861 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| N8153_RS18555 (3793949) | 3793949..3795586 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| N8153_RS18560 (3795814) | 3795814..3796605 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| N8153_RS18565 (3796676) | 3796676..3797011 | - | 336 | WP_000254741.1 | endoribonuclease MazF | Toxin |
| N8153_RS18570 (3797011) | 3797011..3797259 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| N8153_RS18575 (3797337) | 3797337..3799571 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| N8153_RS18580 (3799619) | 3799619..3800920 | - | 1302 | WP_000046810.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12114.04 Da Isoelectric Point: 8.2618
>T259723 WP_000254741.1 NZ_CP106756:c3797011-3796676 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGSTKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGSTKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1V3W215 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1UB4 | |
| PDB | 5CQX | |
| PDB | 5CQY | |
| PDB | 1MVF | |
| PDB | 2MRN | |
| PDB | 2MRU | |
| AlphaFold DB | A0A7U9LMB4 |