Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2534758..2535284 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | N8153_RS12360 | Protein ID | WP_000323025.1 |
| Coordinates | 2534758..2535045 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | N8153_RS12365 | Protein ID | WP_000534858.1 |
| Coordinates | 2535045..2535284 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS12295 (2529786) | 2529786..2529851 | - | 66 | WP_120795388.1 | small protein YnfR | - |
| N8153_RS12300 (2529854) | 2529854..2530042 | - | 189 | WP_071524604.1 | cold-shock protein | - |
| N8153_RS12305 (2530053) | 2530053..2530265 | - | 213 | WP_000066495.1 | cold shock protein CspI | - |
| N8153_RS12310 (2530628) | 2530628..2531125 | - | 498 | WP_001071769.1 | DUF2514 domain-containing protein | - |
| N8153_RS12315 (2531122) | 2531122..2531655 | - | 534 | WP_001092971.1 | lysozyme | - |
| N8153_RS12320 (2531652) | 2531652..2531963 | - | 312 | WP_000189910.1 | YdfR family protein | - |
| N8153_RS12325 (2531968) | 2531968..2532183 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| N8153_RS12330 (2532403) | 2532403..2532573 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
| N8153_RS12335 (2532937) | 2532937..2533152 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| N8153_RS12340 (2533453) | 2533453..2533665 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| N8153_RS12345 (2533720) | 2533720..2533809 | + | 90 | WP_120795389.1 | hypothetical protein | - |
| N8153_RS12350 (2534087) | 2534087..2534347 | - | 261 | Protein_2398 | antitermination protein | - |
| N8153_RS12355 (2534531) | 2534531..2534686 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| N8153_RS12360 (2534758) | 2534758..2535045 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| N8153_RS12365 (2535045) | 2535045..2535284 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| N8153_RS12370 (2535309) | 2535309..2535614 | + | 306 | WP_001326990.1 | protein YdfV | - |
| N8153_RS12375 (2535817) | 2535817..2536149 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
| N8153_RS12380 (2536586) | 2536586..2536735 | - | 150 | WP_263082490.1 | protein YdfW | - |
| N8153_RS12385 (2536808) | 2536808..2537878 | - | 1071 | Protein_2405 | ISNCY family transposase | - |
| N8153_RS12390 (2538668) | 2538668..2538955 | - | 288 | Protein_2406 | hypothetical protein | - |
| N8153_RS12395 (2539433) | 2539433..2539922 | - | 490 | Protein_2407 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2506264..2558166 | 51902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T259717 WP_000323025.1 NZ_CP106756:c2535045-2534758 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|