Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2393236..2393874 | Replicon | chromosome |
Accession | NZ_CP106756 | ||
Organism | Escherichia coli strain B-JRPT-4119 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N8153_RS11650 | Protein ID | WP_000813794.1 |
Coordinates | 2393236..2393412 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N8153_RS11655 | Protein ID | WP_001270286.1 |
Coordinates | 2393458..2393874 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8153_RS11630 (2388855) | 2388855..2390069 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
N8153_RS11635 (2390122) | 2390122..2390658 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
N8153_RS11640 (2390731) | 2390731..2392692 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N8153_RS11645 (2392784) | 2392784..2393014 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N8153_RS11650 (2393236) | 2393236..2393412 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N8153_RS11655 (2393458) | 2393458..2393874 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N8153_RS11660 (2393953) | 2393953..2395359 | + | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
N8153_RS11665 (2395604) | 2395604..2396749 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
N8153_RS11670 (2396767) | 2396767..2397780 | + | 1014 | WP_000220415.1 | ABC transporter ATP-binding protein | - |
N8153_RS11675 (2397781) | 2397781..2398722 | + | 942 | WP_001251313.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T259715 WP_000813794.1 NZ_CP106756:2393236-2393412 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT259715 WP_001270286.1 NZ_CP106756:2393458-2393874 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|