Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1371578..1372415 | Replicon | chromosome |
Accession | NZ_CP106756 | ||
Organism | Escherichia coli strain B-JRPT-4119 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A140NB16 |
Locus tag | N8153_RS06585 | Protein ID | WP_000227786.1 |
Coordinates | 1371578..1372120 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | N8153_RS06590 | Protein ID | WP_001297137.1 |
Coordinates | 1372104..1372415 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8153_RS06565 (1367108) | 1367108..1368019 | - | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
N8153_RS06570 (1368187) | 1368187..1368678 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
N8153_RS06575 (1368806) | 1368806..1370170 | - | 1365 | WP_001000978.1 | MFS transporter | - |
N8153_RS06580 (1370587) | 1370587..1371522 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
N8153_RS06585 (1371578) | 1371578..1372120 | - | 543 | WP_000227786.1 | GNAT family N-acetyltransferase | Toxin |
N8153_RS06590 (1372104) | 1372104..1372415 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
N8153_RS06595 (1372600) | 1372600..1373490 | - | 891 | WP_000971336.1 | heme o synthase | - |
N8153_RS06600 (1373502) | 1373502..1373831 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
N8153_RS06605 (1373831) | 1373831..1374445 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
N8153_RS06610 (1374435) | 1374435..1376426 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
N8153_RS06615 (1376448) | 1376448..1377395 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19794.98 Da Isoelectric Point: 8.3395
>T259713 WP_000227786.1 NZ_CP106756:c1372120-1371578 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140NB16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6B3 |