Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 4566651..4567288 | Replicon | chromosome |
Accession | NZ_CP106754 | ||
Organism | Kosakonia sp. ML.JS2a |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N7922_RS21560 | Protein ID | WP_263098199.1 |
Coordinates | 4566651..4566821 (+) | Length | 57 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N7922_RS21565 | Protein ID | WP_263098200.1 |
Coordinates | 4566851..4567288 (+) | Length | 146 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7922_RS21550 (N7922_21550) | 4564000..4565364 | + | 1365 | WP_263098197.1 | efflux transporter outer membrane subunit | - |
N7922_RS21555 (N7922_21555) | 4565411..4566574 | + | 1164 | WP_263098198.1 | multidrug effflux MFS transporter | - |
N7922_RS21560 (N7922_21560) | 4566651..4566821 | + | 171 | WP_263098199.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N7922_RS21565 (N7922_21565) | 4566851..4567288 | + | 438 | WP_263098200.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N7922_RS21570 (N7922_21570) | 4567285..4568178 | - | 894 | WP_263098201.1 | MurR/RpiR family transcriptional regulator | - |
N7922_RS21575 (N7922_21575) | 4568190..4569137 | - | 948 | WP_263098202.1 | iron-siderophore ABC transporter substrate-binding protein | - |
N7922_RS21580 (N7922_21580) | 4569153..4570205 | - | 1053 | WP_263098203.1 | iron ABC transporter permease | - |
N7922_RS21585 (N7922_21585) | 4570202..4571179 | - | 978 | WP_263100974.1 | iron ABC transporter permease | - |
N7922_RS21590 (N7922_21590) | 4571224..4572051 | - | 828 | WP_263098204.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 57 a.a. Molecular weight: 6392.65 Da Isoelectric Point: 11.0962
>T259707 WP_263098199.1 NZ_CP106754:4566651-4566821 [Kosakonia sp. ML.JS2a]
MKYSEFRKWLLLIKAPGGGSHFKVKLNGRASVFPFHGSKEIPEPLRKKILKDLGLQ
MKYSEFRKWLLLIKAPGGGSHFKVKLNGRASVFPFHGSKEIPEPLRKKILKDLGLQ
Download Length: 171 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 15926.27 Da Isoelectric Point: 4.7503
>AT259707 WP_263098200.1 NZ_CP106754:4566851-4567288 [Kosakonia sp. ML.JS2a]
MFNYPVSVEQDDVTGQFVVSCRDLPLMNSVGDTLDDALLQSVDAMVVAIAIEVDERRPIPQASAALPGEYVVSLPVLVAM
KAALHNAMIETGTRKAELARKLGQKGPQIDRLLDVEHSSKVETVELALHQLNRQIDLTITQQHRT
MFNYPVSVEQDDVTGQFVVSCRDLPLMNSVGDTLDDALLQSVDAMVVAIAIEVDERRPIPQASAALPGEYVVSLPVLVAM
KAALHNAMIETGTRKAELARKLGQKGPQIDRLLDVEHSSKVETVELALHQLNRQIDLTITQQHRT
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|