Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-DinJ |
Location | 4530661..4531225 | Replicon | chromosome |
Accession | NZ_CP106754 | ||
Organism | Kosakonia sp. ML.JS2a |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7922_RS21390 | Protein ID | WP_263098168.1 |
Coordinates | 4530661..4530969 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1C4A1Z8 |
Locus tag | N7922_RS21395 | Protein ID | WP_061497949.1 |
Coordinates | 4530953..4531225 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7922_RS21365 (N7922_21365) | 4526750..4527217 | - | 468 | WP_061497942.1 | YjiG family protein | - |
N7922_RS21370 (N7922_21370) | 4527210..4527893 | - | 684 | WP_263098164.1 | nucleoside recognition domain-containing protein | - |
N7922_RS21375 (N7922_21375) | 4528271..4529167 | + | 897 | WP_263098165.1 | LysR substrate-binding domain-containing protein | - |
N7922_RS21380 (N7922_21380) | 4529211..4529981 | + | 771 | WP_263098166.1 | AraC family transcriptional regulator | - |
N7922_RS21385 (N7922_21385) | 4530032..4530655 | + | 624 | WP_263098167.1 | LysE family translocator | - |
N7922_RS21390 (N7922_21390) | 4530661..4530969 | - | 309 | WP_263098168.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
N7922_RS21395 (N7922_21395) | 4530953..4531225 | - | 273 | WP_061497949.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N7922_RS21400 (N7922_21400) | 4531311..4532591 | + | 1281 | WP_263098169.1 | DUF445 domain-containing protein | - |
N7922_RS21405 (N7922_21405) | 4532612..4532851 | + | 240 | WP_263098170.1 | DUF2164 domain-containing protein | - |
N7922_RS21410 (N7922_21410) | 4532974..4534125 | + | 1152 | WP_263098171.1 | double-cubane-cluster-containing anaerobic reductase | - |
N7922_RS21415 (N7922_21415) | 4534135..4534905 | + | 771 | WP_263098172.1 | putative 2-hydroxyacyl-CoA dehydratase activator YjiL | - |
N7922_RS21420 (N7922_21420) | 4534898..4535134 | + | 237 | WP_263098173.1 | DUF3343 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11532.21 Da Isoelectric Point: 8.0942
>T259706 WP_263098168.1 NZ_CP106754:c4530969-4530661 [Kosakonia sp. ML.JS2a]
MMGKSKRAPLPYRSDYTKTFVKAWARYNKAGRRDMHETAAIMSMVLSGNPLPAQYSDHALTGNMHGFRELHPGGDYLLVY
CVDEAKHLVVFTDLGTHAELFE
MMGKSKRAPLPYRSDYTKTFVKAWARYNKAGRRDMHETAAIMSMVLSGNPLPAQYSDHALTGNMHGFRELHPGGDYLLVY
CVDEAKHLVVFTDLGTHAELFE
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|