Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3984794..3985410 | Replicon | chromosome |
| Accession | NZ_CP106754 | ||
| Organism | Kosakonia sp. ML.JS2a | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1C4ALL4 |
| Locus tag | N7922_RS18870 | Protein ID | WP_061497097.1 |
| Coordinates | 3985192..3985410 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A1C4ALI7 |
| Locus tag | N7922_RS18865 | Protein ID | WP_061497094.1 |
| Coordinates | 3984794..3985168 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7922_RS18855 (N7922_18855) | 3979915..3981108 | + | 1194 | WP_263097758.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N7922_RS18860 (N7922_18860) | 3981131..3984280 | + | 3150 | WP_263097759.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N7922_RS18865 (N7922_18865) | 3984794..3985168 | + | 375 | WP_061497094.1 | Hha toxicity modulator TomB | Antitoxin |
| N7922_RS18870 (N7922_18870) | 3985192..3985410 | + | 219 | WP_061497097.1 | HHA domain-containing protein | Toxin |
| N7922_RS18875 (N7922_18875) | 3985485..3986051 | + | 567 | WP_263097760.1 | maltose O-acetyltransferase | - |
| N7922_RS18880 (N7922_18880) | 3986152..3986631 | + | 480 | WP_263097761.1 | YlaC family protein | - |
| N7922_RS18885 (N7922_18885) | 3986597..3988045 | - | 1449 | WP_263097762.1 | PLP-dependent aminotransferase family protein | - |
| N7922_RS18890 (N7922_18890) | 3988144..3988845 | + | 702 | WP_263097763.1 | GNAT family protein | - |
| N7922_RS18895 (N7922_18895) | 3988842..3988982 | - | 141 | WP_088236752.1 | type B 50S ribosomal protein L36 | - |
| N7922_RS18900 (N7922_18900) | 3988986..3989246 | - | 261 | WP_061497109.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.01 Da Isoelectric Point: 7.9892
>T259705 WP_061497097.1 NZ_CP106754:3985192-3985410 [Kosakonia sp. ML.JS2a]
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSEKPLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14486.34 Da Isoelectric Point: 5.8926
>AT259705 WP_061497094.1 NZ_CP106754:3984794-3985168 [Kosakonia sp. ML.JS2a]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKTGNKLFRCFVNVSKANPVSHSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESHHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKTGNKLFRCFVNVSKANPVSHSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C4ALL4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C4ALI7 |