Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 900504..901167 | Replicon | chromosome |
| Accession | NZ_CP106754 | ||
| Organism | Kosakonia sp. ML.JS2a | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | N7922_RS04295 | Protein ID | WP_263099400.1 |
| Coordinates | 900751..901167 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | N7922_RS04290 | Protein ID | WP_263099399.1 |
| Coordinates | 900504..900770 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7922_RS04270 (N7922_04270) | 896049..897482 | - | 1434 | WP_263099397.1 | 6-phospho-beta-glucosidase | - |
| N7922_RS04275 (N7922_04275) | 897600..898328 | - | 729 | WP_263100829.1 | MurR/RpiR family transcriptional regulator | - |
| N7922_RS04280 (N7922_04280) | 898567..899226 | + | 660 | WP_263099398.1 | hemolysin III family protein | - |
| N7922_RS04285 (N7922_04285) | 899272..900255 | - | 984 | WP_061493247.1 | tRNA-modifying protein YgfZ | - |
| N7922_RS04290 (N7922_04290) | 900504..900770 | + | 267 | WP_263099399.1 | FAD assembly factor SdhE | Antitoxin |
| N7922_RS04295 (N7922_04295) | 900751..901167 | + | 417 | WP_263099400.1 | protein YgfX | Toxin |
| N7922_RS04300 (N7922_04300) | 901186..901707 | - | 522 | WP_263099401.1 | flavodoxin FldB | - |
| N7922_RS04305 (N7922_04305) | 901806..902702 | + | 897 | WP_088237748.1 | site-specific tyrosine recombinase XerD | - |
| N7922_RS04310 (N7922_04310) | 902726..903436 | + | 711 | WP_263099402.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N7922_RS04315 (N7922_04315) | 903442..905175 | + | 1734 | WP_263099403.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16389.44 Da Isoelectric Point: 11.4553
>T259696 WP_263099400.1 NZ_CP106754:900751-901167 [Kosakonia sp. ML.JS2a]
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLLLLSLVVFDCVRSQRRINACHGEIKLLMESRLRWQGV
EWHIVGAPWMLRSGMMLRLRREEDGRRQHLWLAADSMDAQEWRDLRRMLSQKPAQGLR
VVLWQSDLRVSWRAQWLSLLLHGLVAALILLMPWPLSYTPLWLLLLSLVVFDCVRSQRRINACHGEIKLLMESRLRWQGV
EWHIVGAPWMLRSGMMLRLRREEDGRRQHLWLAADSMDAQEWRDLRRMLSQKPAQGLR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|