Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 365211..365910 | Replicon | chromosome |
| Accession | NZ_CP106754 | ||
| Organism | Kosakonia sp. ML.JS2a | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N7922_RS01625 | Protein ID | WP_263098977.1 |
| Coordinates | 365211..365600 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N7922_RS01630 | Protein ID | WP_263098978.1 |
| Coordinates | 365593..365910 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7922_RS01605 (N7922_01605) | 360702..361760 | - | 1059 | WP_263098973.1 | class I SAM-dependent methyltransferase | - |
| N7922_RS01610 (N7922_01610) | 361833..362222 | - | 390 | WP_263098974.1 | hypothetical protein | - |
| N7922_RS01615 (N7922_01615) | 362722..363771 | - | 1050 | WP_263098975.1 | AI-2E family transporter | - |
| N7922_RS01620 (N7922_01620) | 363884..365122 | + | 1239 | WP_263098976.1 | MFS transporter | - |
| N7922_RS01625 (N7922_01625) | 365211..365600 | + | 390 | WP_263098977.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7922_RS01630 (N7922_01630) | 365593..365910 | + | 318 | WP_263098978.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N7922_RS01635 (N7922_01635) | 365982..366539 | - | 558 | WP_263098979.1 | DcrB family lipoprotein | - |
| N7922_RS01640 (N7922_01640) | 366612..367277 | - | 666 | WP_263098980.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
| N7922_RS01645 (N7922_01645) | 367465..367710 | + | 246 | WP_263098981.1 | sulfurtransferase TusA | - |
| N7922_RS01650 (N7922_01650) | 367707..369926 | - | 2220 | WP_263098982.1 | Zn(II)/Cd(II)/Pb(II) translocating P-type ATPase ZntA | - |
| N7922_RS01655 (N7922_01655) | 370002..370628 | - | 627 | WP_263098983.1 | lysoplasmalogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14786.13 Da Isoelectric Point: 6.7105
>T259695 WP_263098977.1 NZ_CP106754:365211-365600 [Kosakonia sp. ML.JS2a]
MGIYLTMEFDQERRRVRISDKTLCKTAAAIIAGLHGDRLGKFTYKKRIALPAVSSRDGARAIVFFHEGDNLFFFDMYVKS
ELSKKKGKELEEDEIDAYCAVAKDFMVMPEETLARLLKSDDLIEVKCHE
MGIYLTMEFDQERRRVRISDKTLCKTAAAIIAGLHGDRLGKFTYKKRIALPAVSSRDGARAIVFFHEGDNLFFFDMYVKS
ELSKKKGKELEEDEIDAYCAVAKDFMVMPEETLARLLKSDDLIEVKCHE
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|