Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1692758..1693286 | Replicon | chromosome |
| Accession | NZ_CP106752 | ||
| Organism | Psychrobacter sp. SC65A.3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OEG80_RS07160 | Protein ID | WP_263240093.1 |
| Coordinates | 1692999..1693286 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | X0RAH8 |
| Locus tag | OEG80_RS07155 | Protein ID | WP_020443322.1 |
| Coordinates | 1692758..1693009 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG80_RS07140 (SC65A3_01448) | 1688368..1688727 | + | 360 | WP_011513459.1 | DUF493 domain-containing protein | - |
| OEG80_RS07145 (SC65A3_01449) | 1689290..1691566 | + | 2277 | WP_263240089.1 | class 1a ribonucleoside-diphosphate reductase subunit alpha | - |
| OEG80_RS07150 (SC65A3_01450) | 1691699..1692586 | + | 888 | WP_263240091.1 | hypothetical protein | - |
| OEG80_RS07155 (SC65A3_01451) | 1692758..1693009 | + | 252 | WP_020443322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OEG80_RS07160 (SC65A3_01452) | 1692999..1693286 | + | 288 | WP_263240093.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| OEG80_RS07165 (SC65A3_01453) | 1693357..1693740 | + | 384 | WP_011513455.1 | hypothetical protein | - |
| OEG80_RS07170 (SC65A3_01454) | 1693812..1694945 | + | 1134 | WP_020443319.1 | class Ia ribonucleoside-diphosphate reductase subunit beta | - |
| OEG80_RS07175 (SC65A3_01455) | 1695143..1695409 | + | 267 | WP_011513453.1 | class I ribonucleotide reductase maintenance protein YfaE | - |
| OEG80_RS07180 (SC65A3_01456) | 1695534..1696862 | - | 1329 | WP_149492686.1 | trypsin-like peptidase domain-containing protein | - |
| OEG80_RS07185 (SC65A3_01457) | 1697122..1697940 | + | 819 | WP_263240095.1 | Nif3-like dinuclear metal center hexameric protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11054.89 Da Isoelectric Point: 10.5715
>T259692 WP_263240093.1 NZ_CP106752:1692999-1693286 [Psychrobacter sp. SC65A.3]
MTYNLEFHPLALKEWKKLAPSIQQQFKKKLQQRLSNPHVPASKLSGHTDTYKIKLRTVGYRLVYTVKDDVVVVYVLAVGK
RENNKVYDNLATRQP
MTYNLEFHPLALKEWKKLAPSIQQQFKKKLQQRLSNPHVPASKLSGHTDTYKIKLRTVGYRLVYTVKDDVVVVYVLAVGK
RENNKVYDNLATRQP
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|