Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1569134..1569623 | Replicon | chromosome |
| Accession | NZ_CP106751 | ||
| Organism | Granulicatella adiacens strain KHUD_009 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N8I82_RS07690 | Protein ID | WP_263089904.1 |
| Coordinates | 1569134..1569400 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N8I82_RS07695 | Protein ID | WP_263089906.1 |
| Coordinates | 1569390..1569623 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I82_RS07675 (N8I82_07675) | 1565954..1567099 | - | 1146 | WP_263089898.1 | low temperature requirement protein A | - |
| N8I82_RS07680 (N8I82_07680) | 1568153..1568560 | - | 408 | WP_263089900.1 | hypothetical protein | - |
| N8I82_RS07685 (N8I82_07685) | 1568557..1569048 | - | 492 | WP_263089902.1 | hypothetical protein | - |
| N8I82_RS07690 (N8I82_07690) | 1569134..1569400 | - | 267 | WP_263089904.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8I82_RS07695 (N8I82_07695) | 1569390..1569623 | - | 234 | WP_263089906.1 | DUF6290 family protein | Antitoxin |
| N8I82_RS07700 (N8I82_07700) | 1569697..1569876 | - | 180 | WP_263089907.1 | hypothetical protein | - |
| N8I82_RS07705 (N8I82_07705) | 1569967..1570200 | + | 234 | WP_263089908.1 | DUF2188 domain-containing protein | - |
| N8I82_RS07710 (N8I82_07710) | 1570197..1570340 | - | 144 | WP_263089910.1 | hypothetical protein | - |
| N8I82_RS07715 (N8I82_07715) | 1570415..1570879 | + | 465 | WP_263089912.1 | hypothetical protein | - |
| N8I82_RS07720 (N8I82_07720) | 1570869..1571096 | - | 228 | WP_263089913.1 | hypothetical protein | - |
| N8I82_RS07725 (N8I82_07725) | 1571089..1571277 | - | 189 | WP_263089914.1 | hypothetical protein | - |
| N8I82_RS07730 (N8I82_07730) | 1571268..1571561 | - | 294 | WP_263089916.1 | hypothetical protein | - |
| N8I82_RS07735 (N8I82_07735) | 1571681..1572541 | - | 861 | WP_263089918.1 | ATP-binding protein | - |
| N8I82_RS07740 (N8I82_07740) | 1572835..1573290 | - | 456 | WP_263089920.1 | phage replisome organizer N-terminal domain-containing protein | - |
| N8I82_RS07745 (N8I82_07745) | 1573493..1573720 | - | 228 | WP_263089921.1 | hypothetical protein | - |
| N8I82_RS07750 (N8I82_07750) | 1573758..1573910 | - | 153 | WP_263089922.1 | hypothetical protein | - |
| N8I82_RS07755 (N8I82_07755) | 1573950..1574222 | - | 273 | WP_263089924.1 | hypothetical protein | - |
| N8I82_RS07760 (N8I82_07760) | 1574259..1574462 | - | 204 | WP_263089925.1 | transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | clpP | 1544538..1595183 | 50645 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10566.50 Da Isoelectric Point: 10.2555
>T259690 WP_263089904.1 NZ_CP106751:c1569400-1569134 [Granulicatella adiacens]
MSYKLVLSNRARKQLKKMDRLVSVMLLDELLNKYDGLENPRQHGKALKGELKKYWRYRIGNYRIICDIQDDKMIVLALEI
GHRKEIYQ
MSYKLVLSNRARKQLKKMDRLVSVMLLDELLNKYDGLENPRQHGKALKGELKKYWRYRIGNYRIICDIQDDKMIVLALEI
GHRKEIYQ
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|