Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
| Location | 2522600..2523642 | Replicon | chromosome |
| Accession | NZ_CP106745 | ||
| Organism | Pseudomonas aeruginosa strain PALA17 | ||
Toxin (Protein)
| Gene name | PP_4152 | Uniprot ID | - |
| Locus tag | PALA17_RS12200 | Protein ID | WP_003153636.1 |
| Coordinates | 2523067..2523642 (+) | Length | 192 a.a. |
Antitoxin (Protein)
| Gene name | PP_4151 | Uniprot ID | I3TV68 |
| Locus tag | PALA17_RS12195 | Protein ID | WP_003050245.1 |
| Coordinates | 2522600..2523070 (+) | Length | 157 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA17_RS12160 (PALA17_02411) | 2517979..2519397 | - | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
| PALA17_RS12165 (PALA17_02412) | 2519387..2520298 | - | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
| PALA17_RS12170 (PALA17_02413) | 2520295..2520987 | - | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
| PALA17_RS12175 (PALA17_02414) | 2520984..2521394 | - | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
| PALA17_RS12180 (PALA17_02415) | 2521407..2521766 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PALA17_RS12185 (PALA17_02416) | 2521783..2522016 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
| PALA17_RS12190 (PALA17_02417) | 2522013..2522396 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
| PALA17_RS12195 (PALA17_02418) | 2522600..2523070 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PALA17_RS12200 (PALA17_02419) | 2523067..2523642 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
| PALA17_RS12205 (PALA17_02420) | 2523660..2524574 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
| PALA17_RS12210 (PALA17_02421) | 2524571..2525041 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
| PALA17_RS12215 (PALA17_02422) | 2525038..2525538 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
| PALA17_RS12220 (PALA17_02423) | 2525538..2526440 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
| PALA17_RS12225 (PALA17_02424) | 2526479..2527204 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2462051..2573169 | 111118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259684 WP_003153636.1 NZ_CP106745:2523067-2523642 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259684 WP_003050245.1 NZ_CP106745:2522600-2523070 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|