Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PP_4151-4152/excise(antitoxin)
Location 2522600..2523642 Replicon chromosome
Accession NZ_CP106745
Organism Pseudomonas aeruginosa strain PALA17

Toxin (Protein)


Gene name PP_4152 Uniprot ID -
Locus tag PALA17_RS12200 Protein ID WP_003153636.1
Coordinates 2523067..2523642 (+) Length 192 a.a.

Antitoxin (Protein)


Gene name PP_4151 Uniprot ID I3TV68
Locus tag PALA17_RS12195 Protein ID WP_003050245.1
Coordinates 2522600..2523070 (+) Length 157 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA17_RS12160 (PALA17_02411) 2517979..2519397 - 1419 WP_004350605.1 TIGR03752 family integrating conjugative element protein -
PALA17_RS12165 (PALA17_02412) 2519387..2520298 - 912 WP_004350604.1 TIGR03749 family integrating conjugative element protein -
PALA17_RS12170 (PALA17_02413) 2520295..2520987 - 693 WP_012614071.1 TIGR03746 family integrating conjugative element protein -
PALA17_RS12175 (PALA17_02414) 2520984..2521394 - 411 WP_003821108.1 TIGR03750 family conjugal transfer protein -
PALA17_RS12180 (PALA17_02415) 2521407..2521766 - 360 WP_003153634.1 TIGR03745 family integrating conjugative element membrane protein -
PALA17_RS12185 (PALA17_02416) 2521783..2522016 - 234 WP_003050225.1 TIGR03758 family integrating conjugative element protein -
PALA17_RS12190 (PALA17_02417) 2522013..2522396 - 384 WP_003090167.1 RAQPRD family integrative conjugative element protein -
PALA17_RS12195 (PALA17_02418) 2522600..2523070 + 471 WP_003050245.1 helix-turn-helix domain-containing protein Antitoxin
PALA17_RS12200 (PALA17_02419) 2523067..2523642 + 576 WP_003153636.1 PIN domain-containing protein Toxin
PALA17_RS12205 (PALA17_02420) 2523660..2524574 + 915 WP_003050256.1 AAA family ATPase -
PALA17_RS12210 (PALA17_02421) 2524571..2525041 + 471 WP_003153638.1 type III CBASS phage resistance system CD-NTase-associated protein Cap8 -
PALA17_RS12215 (PALA17_02422) 2525038..2525538 + 501 WP_003090159.1 type III CBASS phage resistance system CD-NTase-associated protein Cap7 -
PALA17_RS12220 (PALA17_02423) 2525538..2526440 + 903 WP_003153640.1 CBASS oligonucleotide cyclase -
PALA17_RS12225 (PALA17_02424) 2526479..2527204 + 726 WP_003050273.1 CBASS effector endonuclease NucC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2462051..2573169 111118


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

Helix-turn-helix domain, group 17

(85-133)


Sequences

Toxin        


Download         Length: 192 a.a.        Molecular weight: 21629.78 Da        Isoelectric Point: 5.9995

>T259684 WP_003153636.1 NZ_CP106745:2523067-2523642 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL

Download         Length: 576 bp

Antitoxin


Download         Length: 157 a.a.        Molecular weight: 17245.62 Da        Isoelectric Point: 6.3803

>AT259684 WP_003050245.1 NZ_CP106745:2522600-2523070 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE

Download         Length: 471 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB I3TV68

References