Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1166517..1167174 Replicon chromosome
Accession NZ_CP106745
Organism Pseudomonas aeruginosa strain PALA17

Toxin (Protein)


Gene name hicA Uniprot ID A0A8G3IXE4
Locus tag PALA17_RS05590 Protein ID WP_003098540.1
Coordinates 1166992..1167174 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PALA17_RS05585 Protein ID WP_004351284.1
Coordinates 1166517..1166945 (-) Length 143 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA17_RS05550 (PALA17_01100) 1162530..1163234 + 705 WP_012613696.1 phage regulatory protein/antirepressor Ant -
PALA17_RS05555 (PALA17_01101) 1163299..1164132 + 834 WP_012613697.1 helix-turn-helix domain-containing protein -
PALA17_RS05560 (PALA17_01102) 1164119..1164916 + 798 WP_012613698.1 hypothetical protein -
PALA17_RS05565 (PALA17_01103) 1164913..1165119 + 207 WP_024082445.1 hypothetical protein -
PALA17_RS05570 (PALA17_01104) 1165116..1165697 + 582 WP_012613699.1 recombination protein NinG -
PALA17_RS05575 (PALA17_01105) 1165694..1165990 + 297 WP_024082446.1 hypothetical protein -
PALA17_RS05580 (PALA17_01106) 1165992..1166366 + 375 WP_004351286.1 antiterminator Q family protein -
PALA17_RS05585 (PALA17_01107) 1166517..1166945 - 429 WP_004351284.1 hypothetical protein Antitoxin
PALA17_RS05590 (PALA17_01108) 1166992..1167174 - 183 WP_003098540.1 type II toxin-antitoxin system HicA family toxin Toxin
PALA17_RS05595 (PALA17_01109) 1167375..1167689 + 315 WP_015649339.1 phage holin, lambda family -
PALA17_RS05600 (PALA17_01110) 1167689..1168306 + 618 WP_012613700.1 glycoside hydrolase family 19 protein -
PALA17_RS05605 1168327..1168776 + 450 WP_024082447.1 lysis system i-spanin subunit Rz -
PALA17_RS05610 (PALA17_01112) 1168773..1169516 + 744 WP_012613702.1 hypothetical protein -
PALA17_RS05615 (PALA17_01113) 1169636..1170181 + 546 WP_019486501.1 terminase small subunit -
PALA17_RS05620 (PALA17_01114) 1170153..1172117 + 1965 WP_012613704.1 phage terminase large subunit family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1149018..1191980 42962


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(7-78)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6746.86 Da        Isoelectric Point: 11.0775

>T259682 WP_003098540.1 NZ_CP106745:c1167174-1166992 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 143 a.a.        Molecular weight: 15756.94 Da        Isoelectric Point: 4.6562

>AT259682 WP_004351284.1 NZ_CP106745:c1166945-1166517 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKVHAIGEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KIALWNEMVRRDMRKADLCRLLGIAQTQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA

Download         Length: 429 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References