Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 114433..114938 | Replicon | chromosome |
| Accession | NZ_CP106745 | ||
| Organism | Pseudomonas aeruginosa strain PALA17 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PALA17_RS00525 | Protein ID | WP_003083773.1 |
| Coordinates | 114657..114938 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PALA17_RS00520 | Protein ID | WP_003083775.1 |
| Coordinates | 114433..114660 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA17_RS00495 (PALA17_00100) | 109451..110944 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| PALA17_RS00500 (PALA17_00101) | 111113..112540 | + | 1428 | WP_003083784.1 | GABA permease | - |
| PALA17_RS00505 (PALA17_00102) | 112622..112963 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
| PALA17_RS00510 (PALA17_00103) | 113036..113536 | - | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PALA17_RS00515 (PALA17_00104) | 113637..114257 | + | 621 | WP_003101226.1 | hypothetical protein | - |
| PALA17_RS00520 (PALA17_00105) | 114433..114660 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PALA17_RS00525 (PALA17_00106) | 114657..114938 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PALA17_RS00530 (PALA17_00107) | 115238..116146 | + | 909 | WP_012613448.1 | LysR family transcriptional regulator | - |
| PALA17_RS00535 (PALA17_00108) | 116178..116588 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
| PALA17_RS00540 (PALA17_00109) | 116768..117502 | - | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| PALA17_RS00545 (PALA17_00110) | 117603..118289 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
| PALA17_RS00550 (PALA17_00111) | 118338..119687 | - | 1350 | WP_012613447.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T259681 WP_003083773.1 NZ_CP106745:114657-114938 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|