Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5586761..5587347 | Replicon | chromosome |
Accession | NZ_CP106744 | ||
Organism | Pseudomonas aeruginosa strain PALA16 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | PALA16_RS26235 | Protein ID | WP_003120987.1 |
Coordinates | 5587048..5587347 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PALA16_RS26230 | Protein ID | WP_003448662.1 |
Coordinates | 5586761..5587051 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA16_RS26205 (PALA16_05200) | 5581912..5582121 | + | 210 | WP_003105733.1 | cold-shock protein | - |
PALA16_RS26210 (PALA16_05201) | 5582343..5584232 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
PALA16_RS26215 (PALA16_05202) | 5584229..5586205 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
PALA16_RS26220 | 5586215..5586349 | + | 135 | WP_255253641.1 | hypothetical protein | - |
PALA16_RS26225 | 5586346..5586690 | + | 345 | WP_016851612.1 | hypothetical protein | - |
PALA16_RS26230 (PALA16_05203) | 5586761..5587051 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
PALA16_RS26235 (PALA16_05204) | 5587048..5587347 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA16_RS26240 (PALA16_05205) | 5587549..5588673 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
PALA16_RS26245 (PALA16_05206) | 5588673..5590382 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
PALA16_RS26250 (PALA16_05207) | 5590386..5591711 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
PALA16_RS26255 (PALA16_05208) | 5591701..5592234 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5560238..5663860 | 103622 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T259679 WP_003120987.1 NZ_CP106744:c5587347-5587048 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|