Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5190219..5190827 | Replicon | chromosome |
Accession | NZ_CP106744 | ||
Organism | Pseudomonas aeruginosa strain PALA16 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | PALA16_RS24385 | Protein ID | WP_003123043.1 |
Coordinates | 5190219..5190566 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | PALA16_RS24390 | Protein ID | WP_003114155.1 |
Coordinates | 5190576..5190827 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA16_RS24355 (PALA16_04832) | 5185578..5185850 | + | 273 | WP_016851967.1 | cysteine-rich CWC family protein | - |
PALA16_RS24360 (PALA16_04833) | 5185850..5186542 | + | 693 | WP_016851968.1 | 16S rRNA pseudouridine(516) synthase | - |
PALA16_RS24365 (PALA16_04834) | 5186678..5187721 | + | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
PALA16_RS24370 (PALA16_04835) | 5187801..5188538 | + | 738 | WP_003085453.1 | murein L,D-transpeptidase catalytic domain family protein | - |
PALA16_RS24375 (PALA16_04836) | 5188990..5189892 | + | 903 | WP_014603238.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
PALA16_RS24385 (PALA16_04838) | 5190219..5190566 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA16_RS24390 | 5190576..5190827 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PALA16_RS24395 (PALA16_04839) | 5191041..5192024 | - | 984 | WP_016852062.1 | tyrosine-type recombinase/integrase | - |
PALA16_RS24400 (PALA16_04840) | 5192024..5193316 | - | 1293 | WP_269972860.1 | hypothetical protein | - |
PALA16_RS24405 (PALA16_04842) | 5193575..5194836 | - | 1262 | Protein_4829 | hypothetical protein | - |
PALA16_RS24410 (PALA16_04844) | 5194838..5195188 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | catB7 | - | 5190219..5212060 | 21841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T259678 WP_003123043.1 NZ_CP106744:c5190566-5190219 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |