Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2808353..2809395 | Replicon | chromosome |
Accession | NZ_CP106744 | ||
Organism | Pseudomonas aeruginosa strain PALA16 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA16_RS13260 | Protein ID | WP_003153636.1 |
Coordinates | 2808820..2809395 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA16_RS13255 | Protein ID | WP_003050245.1 |
Coordinates | 2808353..2808823 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA16_RS13220 (PALA16_02638) | 2803744..2805162 | - | 1419 | WP_003116808.1 | TIGR03752 family integrating conjugative element protein | - |
PALA16_RS13225 (PALA16_02639) | 2805152..2806063 | - | 912 | WP_034022488.1 | TIGR03749 family integrating conjugative element protein | - |
PALA16_RS13230 (PALA16_02640) | 2806060..2806752 | - | 693 | WP_004350603.1 | TIGR03746 family integrating conjugative element protein | - |
PALA16_RS13235 (PALA16_02641) | 2806749..2807147 | - | 399 | WP_003153632.1 | TIGR03750 family conjugal transfer protein | - |
PALA16_RS13240 (PALA16_02642) | 2807160..2807519 | - | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA16_RS13245 (PALA16_02643) | 2807536..2807769 | - | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA16_RS13250 (PALA16_02644) | 2807766..2808149 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA16_RS13255 (PALA16_02645) | 2808353..2808823 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA16_RS13260 (PALA16_02646) | 2808820..2809395 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA16_RS13265 (PALA16_02647) | 2809413..2810327 | + | 915 | WP_003050256.1 | AAA family ATPase | - |
PALA16_RS13270 (PALA16_02648) | 2810324..2810794 | + | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA16_RS13275 (PALA16_02649) | 2810791..2811291 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA16_RS13280 (PALA16_02650) | 2811291..2812193 | + | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
PALA16_RS13285 (PALA16_02651) | 2812232..2812957 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2753974..2858931 | 104957 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259674 WP_003153636.1 NZ_CP106744:2808820-2809395 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259674 WP_003050245.1 NZ_CP106744:2808353-2808823 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|